KEGG   Lactobacillus amylovorus GRL1118: LAB52_03095Help
Entry
LAB52_03095       CDS       T01954                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00071  Fatty acid degradation
lay00072  Synthesis and degradation of ketone bodies
lay00280  Valine, leucine and isoleucine degradation
lay00310  Lysine degradation
lay00362  Benzoate degradation
lay00620  Pyruvate metabolism
lay00630  Glyoxylate and dicarboxylate metabolism
lay00640  Propanoate metabolism
lay00650  Butanoate metabolism
lay00900  Terpenoid backbone biosynthesis
lay01100  Metabolic pathways
lay01110  Biosynthesis of secondary metabolites
lay01120  Microbial metabolism in diverse environments
lay01130  Biosynthesis of antibiotics
lay01200  Carbon metabolism
lay01212  Fatty acid metabolism
lay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAB52_03095
   00630 Glyoxylate and dicarboxylate metabolism
    LAB52_03095
   00640 Propanoate metabolism
    LAB52_03095
   00650 Butanoate metabolism
    LAB52_03095
  Lipid metabolism
   00071 Fatty acid degradation
    LAB52_03095
   00072 Synthesis and degradation of ketone bodies
    LAB52_03095
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LAB52_03095
   00310 Lysine degradation
    LAB52_03095
   00380 Tryptophan metabolism
    LAB52_03095
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAB52_03095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LAB52_03095
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LAB52_03095
Enzymes [BR:lay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LAB52_03095
Exosome [BR:lay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAB52_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEA31593
UniProt: F2LYB8
Position
607419..608579
Genome map
AA seq 386 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDTSAIELGVMALKGTLKAGNINPQDVQALFMGNVLGTG
LGENMARQVALNSGMKQESAAVTINEVCGSSLKAVRLAQGQMEMGDLDLVAVGGSENMTR
APYFVKKEYKADPADHLTSTMINDALMDAFSGKHMGITAENVAERYHVSRKEMDEFSLRS
HQLATKATKSGFFKNEILKVELNGQTLDHDESIRPDTSLEALSNLKPVFKEDGQVTAGNS
SPLNDGASMLVLATKEKMEELHLTPIAKLGAFAEAGFDPAYMGYTPYYAVKKLLAKTGRK
IDDYDIIELNEAFAAQGLAVARDLHIPMDKLNIMGGAIALGHPLGATGTRLVASAISGLK
NRNGKRALVTLCIGGGQAVAYEIENA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggatatatatattgttgcagccaaaagaacaccttttggcaagtatcgtggcttt
tttaaggatacttccgcaattgagttgggagtaatggcattaaaggggactttgaaagcg
ggaaatattaatccgcaagatgttcaagctctttttatgggtaatgttttaggtacaggt
cttggtgaaaatatggcccgtcaagttgctcttaattcagggatgaagcaagagtcagct
gcagtgacaatcaatgaagtttgtggttcaagtttaaaggctgttcgtttggcccaaggt
caaatggaaatgggcgacttggatttggtagctgttggtggtagtgaaaacatgacacgc
gcaccatactttgttaaaaaagaatacaaggctgatccagcagatcacttaaccagtacg
atgatcaacgatgccttaatggatgctttttctggcaaacacatgggaattacagctgaa
aacgttgctgagagatatcatgtttcgcgcaaagaaatggacgaattcagtttacgttca
caccaacttgcaacaaaagcaactaaatctggctttttcaaaaatgaaattttaaaggtt
gaacttaacggtcaaaccttggatcatgatgaatcaattcgtcctgatactagtcttgaa
gccttaagcaacttaaagcccgtctttaaggaagatggtcaagtaacagccggcaattca
tccccattgaatgatggtgccagcatgttagtacttgctactaaagaaaagatggaagaa
ttgcatttaactccaattgctaagttaggtgcatttgcggaagccggttttgatccggct
tacatgggctatactccttactatgccgttaagaagttgttagctaagactggccgcaaa
attgatgattacgacatcatcgaattaaacgaagcttttgctgctcaaggccttgcagtg
gcaagagacttgcacattccaatggataaattgaatattatgggcggcgcgattgcatta
ggtcacccattaggtgcaacaggtacgcgtttagtagcttccgcaattagtggattaaag
aatagaaatggcaagagagctttggttaccttgtgtatcggtggtggccaagcggttgct
tatgaaatcgagaatgcctaa

DBGET integrated database retrieval system