KEGG   Lactobacillus amylovorus GRL1118: LAB52_08735Help
Entry
LAB52_08735       CDS       T01954                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00230  Purine metabolism
lay01100  Metabolic pathways
Module
lay_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LAB52_08735
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LAB52_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ABC_tran AAA_33 AAA_16 AAA_22 AAA_14 ATPase AAA_17 RsgA_GTPase AAA_24 Thymidylate_kin Zeta_toxin AAA_29 PRK AAA_23 Rad17 dNK AAA_5 APS_kinase PduV-EutP T2SSE MMR_HSR1 AAA CPT
Motif
Other DBs
NCBI-ProteinID: AEA32659
UniProt: F2M2N5
Position
complement(1706554..1707102)
Genome map
AA seq 182 aa AA seqDB search
MKKIILIAGPSGAGKTTISDYLYEKYDIPRVLTHTTRPMRVGERQNVSYHFETDDSFKKL
HFFEHVKYGSYQYGSSREALNLAWEKHDLVSLIVDIQGVYSYIKQLGDKVYFLYVTTSTK
EELKERLLKRGDDPEKIKERLSGSELNLLPADLKQYAHVIVNDNLNKTKETLNSIISRLE
ED
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataattttaattgcgggaccaagtggtgctggcaagacgaccatttccgat
tatttatatgaaaaatatgacattccgcgcgttttaacgcataccacacggccaatgcgt
gtcggcgaaaggcagaatgtgtcatatcactttgaaacggatgattcatttaagaaattg
cacttctttgaacatgtaaaatacggttcatatcagtatggttcaagtcgtgaagcatta
aacctcgcttgggaaaaacacgatctggtgtcattaatcgtcgatattcaaggcgtatat
tcttacattaaacaattaggtgacaaagtttatttcttatatgtcacaacttcgactaaa
gaagagctgaaagagcggctgctcaagcgtggcgacgatcctgagaagattaaggaacgc
cttagtggtagcgaattaaacttgcttccagcagatttgaaacaatacgctcatgtaatt
gttaacgataatcttaacaaaactaaagaaacgttaaactcaatcatatcaaggcttgag
gaagactag

DBGET integrated database retrieval system