KEGG   Lelliottia amnigena: A8A57_03465Help
Entry
A8A57_03465       CDS       T04400                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
laz  Lelliottia amnigena
Brite
KEGG Orthology (KO) [BR:laz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A8A57_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ANG91501
UniProt: A0A1A9F737
Position
complement(743298..743675)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSAYIESQSTPDEERFVFAYTVTIRNLGRMPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPMGTMQGHYEMVDVDGNPFRVAIPVFRLAV
HTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattcgccccgcgtctgtgttcaggtacaaagcgcctacattgaatctcaatcc
acgccggatgaagaacgttttgtttttgcttacaccgtcacgattcgcaatctggggcgg
atgcctgtgcaactgcttgggcgttactggcttatcaccaacggcaatggccgcgaaatc
gaagtccagggagaaggcgttgtgggggaacaaccgcacatcgcccctggcgaagagtat
cagtacaccagcggcgccgttatcgagacgccgatgggtacgatgcagggccattatgaa
atggtcgatgtcgatggcaaccccttccgcgttgccattcccgttttccgtctcgccgtt
cacacgctgattcattaa

DBGET integrated database retrieval system