KEGG   Lelliottia amnigena: A8A57_04300Help
Entry
A8A57_04300       CDS       T04400                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
laz  Lelliottia amnigena
Pathway
laz00430  Taurine and hypotaurine metabolism
laz00460  Cyanoamino acid metabolism
laz00480  Glutathione metabolism
laz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A8A57_04300
   00460 Cyanoamino acid metabolism
    A8A57_04300
   00480 Glutathione metabolism
    A8A57_04300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:laz01002]
    A8A57_04300
Enzymes [BR:laz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     A8A57_04300
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     A8A57_04300
Peptidases and inhibitors [BR:laz01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   A8A57_04300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ANG91655
UniProt: A0A1A9F8N1
Position
934529..936130
Genome map
AA seq 533 aa AA seqDB search
MTKALDFKTGYDSRRPPMMGHNAVATSQPLAAQAGMRMLQLGGNAVDAAIATAMALTVVE
PTGCGIGSDAFAIVWDGEKLHGLNASGRSPASWHADLYAGKTAVPELGWDAVTVPGAVSG
WVALAERFGTLPLTTLAQPAIEYARNGFPVSPLIGHLWERGYNKLKDQPGFSACFAPEGR
APRIGEIFRNPAQADSLELIAKTNGEAFYRGELAAKIAAFAKEHGAHLTAEDLANHQVDW
VELLSRDFAGGSVQELPPNGQGIATLIALGILEQCDIGRYDPDSVQSLHLSIEAMKLALA
DLDRYVADESHMEFAAKELLSDRYLKSRAALIDPHKASDFTYGSPVQSGTVYLSAADASG
MMISFIQSNFMGFGSGVVVPETGISLQNRGCGFVLDPKHPNALAGSKRPFHTIIPGFAMD
GNGKPLMSFGVMGGPMQAQGHMQMALRIMMHGQNPQAAIDAPRWRVVQGREVIVESTFDR
NVIAGLRDRGHQIVVEDPLQDYNFGGAQVIYRMPEGHYVAATESRKDGQALVS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgctggattttaaaacgggttacgattcaagacgtccgcccatgatgggg
cacaacgcggtcgctacctcgcagccgctggcggcgcaggccgggatgcgcatgttgcag
ctgggggggaacgccgtggatgccgccattgcaacggcgatggcgcttaccgtggtggag
ccgacgggctgtggtatcggcagtgatgcctttgccattgtctgggatggcgaaaaactg
cacggcctgaacgcgtccggccgctcgcctgccagctggcacgcggatctgtatgccggt
aaaacggccgtgcctgaactgggctgggacgcggtaaccgtgcctggcgcggtatcgggt
tgggtggcgctagccgagcgttttgggacattgccgctgaccacgctggcgcaaccggcc
attgagtatgcgcgtaacggtttcccggtgtcgccgctgattggccacttatgggagcgg
ggatacaacaaacttaaagaccagcccggctttagcgcctgcttcgcgccggaaggccgc
gcgccgcgtatcggagagatcttccgcaatccagcgcaggcggactccctggaactgatt
gcgaaaaccaacggtgaagcgttctaccggggtgagctggccgcgaaaattgccgccttt
gccaaagagcacggcgcgcatttaaccgccgaggatttggcgaaccatcaggttgactgg
gtagaactgctgtcgcgtgatttcgcggggggatccgttcaggaactgccgccgaacggg
caaggcatcgccacgctcatcgcgctggggatcctggagcagtgtgatattggccgctac
gatcccgactcggtgcagtctctgcatctgtcgatcgaggcgatgaagcttgcgctggcg
gatctggatcgttatgtagcggatgaatcacacatggagttcgccgcgaaggagctgctc
agcgatcgttacctgaaatcccgtgccgcgctgatcgacccgcataaagcctctgatttc
acctatggttcgcctgtgcagagcggtacggtttatctctctgcggcggatgccagcgga
atgatgatctcctttattcagtcgaactttatgggctttggctctggcgtcgtggtaccc
gaaacggggatcagcctgcaaaatcgcggctgcggttttgtgctcgatcccaaacatcca
aacgcgctggcgggcagtaaacgtcctttccataccatcattccaggctttgcgatggac
ggcaacggcaagccattgatgtcgttcggggtcatgggaggacccatgcaggcgcagggg
catatgcaaatggcgctgcggatcatgatgcacggacaaaacccgcaggccgcgatagat
gcgccgcgctggcgcgtggtgcagggcagggaggtgattgttgaatccaccttcgatcgc
aacgtcattgccggtttgcgcgatcgcggacatcagatcgtagtggaagacccgcttcag
gattataactttggtggtgcgcaggtaatttatcgtatgccggaaggtcactacgttgcc
gcgaccgagagccgtaaagatggacaggcgttagtgagttaa

DBGET integrated database retrieval system