KEGG   Lelliottia amnigena: A8A57_04720Help
Entry
A8A57_04720       CDS       T04400                                 

Definition
(GenBank) (2E,6E)-farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
laz  Lelliottia amnigena
Pathway
laz00900  Terpenoid backbone biosynthesis
laz01100  Metabolic pathways
laz01110  Biosynthesis of secondary metabolites
laz01130  Biosynthesis of antibiotics
Module
laz_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A8A57_04720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:laz01006]
    A8A57_04720
Enzymes [BR:laz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     A8A57_04720
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     A8A57_04720
Prenyltransferases [BR:laz01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   A8A57_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ANG91736
UniProt: A0A1A9F888
Position
complement(1027592..1028491)
Genome map
AA seq 299 aa AA seqDB search
MDFTHALQARVERANEALRRFIEPQPFQNTPLVEAMHYGALLGGKRLRPFLVYATGNMFG
ISDTTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGQPTCHIKFGEANAILAGDALQTL
AFSILSDAPMTEVADRDRLAMVSELAMASGVAGMCGGQALDLEAEGRQVNLEQLERIHRH
KTGALIRAAVRLGALSAGERGRNALPILDRYADSIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQAQRKARDLIDDARQSLNQLAAHSLDTSALEALADYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttacccacgcgcttcaggcgcgcgttgaacgcgccaacgaggcattgcgccgt
tttattgaaccgcagccttttcagaacactccactggttgaagcgatgcattatggcgca
ctcttaggtggaaagcgtctgcggccgtttctggtctatgccacgggtaatatgtttggc
atcagtgacaccacgctggacgcgccggcagcggccgtggagtgtatccacgcctactcg
ttgatccatgatgatttaccggcgatggacgatgacgatctgcgtcgcggacagccgacc
tgtcacatcaagtttggcgaagccaatgccattctggcgggcgacgcattgcagacgctg
gcgttctccatcttaagcgatgcgccaatgactgaggtggccgaccgcgatcgtctggca
atggtctccgagctggcaatggccagtggcgttgccggtatgtgcgggggccaggcgctg
gatctggaggccgaaggccgtcaggttaatctggaacagctggaacggatccaccggcat
aaaaccggtgccttaatccgtgccgccgtccgtctgggcgcgctgagcgcgggcgagcgc
gggcgcaatgcgctgccgatccttgacagatatgccgacagtattggtctggcattccag
gttcaggatgacattctggatgtggtgggcgatactgcaacattgggaaaacgtcagggt
gcggatcagcagcttggcaaaagtacctaccccgcactgctgggccttgagcaagcccaa
cgtaaagcccgggatctgattgatgatgcccgccagtcactaaatcagctggcggcgcac
tcactggatacctcggcactggaagcgctagcggactatataatccagcgtgataaataa

DBGET integrated database retrieval system