KEGG   Lelliottia amnigena: A8A57_06135Help
Entry
A8A57_06135       CDS       T04400                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
laz  Lelliottia amnigena
Brite
KEGG Orthology (KO) [BR:laz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8A57_06135
Enzymes [BR:laz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     A8A57_06135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ANG92005
UniProt: A0A1A9F9R2
Position
1333044..1333832
Genome map
AA seq 262 aa AA seqDB search
MYVAVGQFAVTPDWQENARHCAELMSQAAGKGASLLVLPEALLARDDNDPDLSVKSAQSL
DGDFLKVLKTESAANTLTTILTLHVPSSPGRAVNTLVALRGGEIVQTYAKLHLYDAFSVQ
ESRHVDPGHQLPPVIEVGGFKLGLMTCYDLRFPEMAMNLALSGADVLILPAAWVKGPLKE
HHWATLLTARALDTTCYVVAAGECGNKNIGQSRVIDPLGVTVAAAAEKPALIIAELDRER
VHAVRQQLPVLRNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgctgtggggcagtttgcggtcacgccagactggcaagaaaatgcacgacat
tgtgcagaactgatgtcgcaggcggcaggcaaaggcgcgtcgctgttagtgttacctgaa
gcgctcctggcgcgtgacgacaacgatccggatctgtcagtgaaatcagcgcagtcgctc
gacggggatttcctgaaagtgctgaaaacagaaagcgcagcgaatacactgaccacgatc
ctcactctgcatgtcccctcatcgccggggagagcggttaacacgctggtggccctgcgg
ggtggggagattgtgcagacctatgccaagcttcatctctacgacgcgttctccgtgcag
gaatcccggcacgtggacccggggcatcagttgccgcccgtcatcgaggtggggggattt
aagctgggtctgatgacctgctacgatctacgcttcccggagatggcgatgaatctggcg
ctgtcaggcgccgatgtattaatccttcccgcggcctgggtgaaagggccgcttaaagag
catcactgggcgaccctgctcacggccagggcgctggataccacctgctatgttgtcgcg
gcaggagagtgcgggaataaaaatattggccaaagccgggtgattgatccgttaggcgtg
acggtcgctgcggcggcagagaaaccggcacttatcatagcggagctcgatcgcgagcgg
gtacacgccgtgcgccagcaactgccggtcttacgcaaccgaagatttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system