KEGG   Lelliottia amnigena: A8A57_09085Help
Entry
A8A57_09085       CDS       T04400                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
laz  Lelliottia amnigena
Pathway
laz00480  Glutathione metabolism
laz00590  Arachidonic acid metabolism
laz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A8A57_09085
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A8A57_09085
Enzymes [BR:laz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A8A57_09085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANG92549
UniProt: A0A1A9FA93
Position
1947918..1948472
Genome map
AA seq 184 aa AA seqDB search
MQDDILNTEVTTIEGEKTTLENYKGNVLLVVNVASKCGLTPQYEQLENIHKAWEKDGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGENRHPLYAKLVAAAPTAVA
PEASGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVVQRFSPDMTPEDPILMESIKLA
LAKS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgatattctgaataccgaagtcaccacgattgagggtgaaaagaccacgctc
gaaaactacaaaggcaacgtgctgctggtggtgaatgtggcttccaaatgtggtctgacg
ccgcaatatgagcagctggagaacattcataaagcctgggagaaagacggctttaccgtg
ctgggcttcccgtgcaatcagttccttggacaggagccgggctcagaggaggagatcaaa
accttctgcagcaccacctatggcgtcactttccctctgtttagcaaaatcgacgtcaac
ggggaaaaccgtcatccgctttatgccaaactggtggcggccgcgccgaccgccgtcgcg
cctgaagccagcggattctacgaacgtatggccagtaaaggtcgcgcgcccctctatccg
gacgacattctgtggaatttcgaaaaattcctgattggtcgtgacgggcaggtcgttcag
cgcttttcacccgatatgacaccagaagatcctattctgatggagtctatcaaactggcg
ctggcaaagtcctga

DBGET integrated database retrieval system