KEGG   Lelliottia amnigena: A8A57_17115Help
Entry
A8A57_17115       CDS       T04400                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
laz  Lelliottia amnigena
Pathway
laz00071  Fatty acid degradation
laz00280  Valine, leucine and isoleucine degradation
laz00310  Lysine degradation
laz00362  Benzoate degradation
laz00380  Tryptophan metabolism
laz00620  Pyruvate metabolism
laz00630  Glyoxylate and dicarboxylate metabolism
laz00640  Propanoate metabolism
laz00650  Butanoate metabolism
laz00900  Terpenoid backbone biosynthesis
laz01100  Metabolic pathways
laz01110  Biosynthesis of secondary metabolites
laz01120  Microbial metabolism in diverse environments
laz01130  Biosynthesis of antibiotics
laz01200  Carbon metabolism
laz01212  Fatty acid metabolism
laz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8A57_17115
   00630 Glyoxylate and dicarboxylate metabolism
    A8A57_17115
   00640 Propanoate metabolism
    A8A57_17115
   00650 Butanoate metabolism
    A8A57_17115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A8A57_17115
   00072 Synthesis and degradation of ketone bodies
    A8A57_17115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A8A57_17115
   00310 Lysine degradation
    A8A57_17115
   00380 Tryptophan metabolism
    A8A57_17115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A8A57_17115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A8A57_17115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A8A57_17115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laz04147]
    A8A57_17115
Enzymes [BR:laz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A8A57_17115
Exosome [BR:laz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A8A57_17115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANG94025
UniProt: A0A1A9FFN8
Position
complement(3684064..3685242)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTAIGCFQGALARHSAVELGSVVLKALVERSGIPAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEAEVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRNEIVPVNTVRQNNELLIVDTDEQPRTDTSAEGLAMLNPAFESTG
SVTAGNASSINDGAAAVMMMSESKAEELNLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLGDVDLIEVNEAFAAQALSVGKMLEWDPQRVNVNGGAIALGHPIGASGCRILV
SLVHEMIKRDARKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggtcgtgatcgtgggggcgttgcgtacggctatcggctgctttcagggggca
ttagcacgtcattccgccgttgagttgggcagcgtggtattgaaagcgctggtggagcgc
agtggcatccccgcgcatgaaattgacgaggtgatcctgggtcaggtcctcacggccggt
gccgggcaaaacccggctcgtcaggcggccttaaaaggcggattacctaacacggtctcg
gctatcaccattaatgatgtgtgtggctccgggctgaaagcgcttcatcttgcgacgcag
gcgatccagtgcggtgaagccgaagtggtgattgcaggcggccaggagaatatgagccgt
gcgccgcatgtgctaacggacagccgcaccggcgcgcagctgggaaacagtcagctgctc
gacagcctggtccacgacgggctgtgggatgcgttcaacgactaccacatgggcgtcacc
gccgaaaacctggcgcgggaatatggtatcagccgcgaacttcaggatgcttacgcgctc
agctcgcagcaaaaagcccgcgcggccattgattccggacgatttcgcaatgagatcgtc
ccggtgaatacggtacgtcagaataatgaactgttaatcgttgatactgatgaacagccg
cgcaccgacaccagcgcagaagggctggcaatgctcaacccggcattcgagagcaccggc
tccgtgacggcaggcaatgcttcttcgattaacgatggtgccgccgccgtgatgatgatg
agtgaatcgaaagcagaagagctcaatttacccgtactggcgcgcatcaaggcttttgcc
agcgtgggcgttgatccggcgttgatggggatcgcgcctgtttacgcgacacgccgatgc
cttgagcgtgcgggctggcagcttggtgatgtagatcttatagaggtgaacgaagctttt
gcggcacaggcgctctctgtaggaaaaatgcttgaatgggatcctcagcgggtgaatgtg
aacggcggcgcgattgcgctcggtcacccgataggggcgtccggctgtcgtattctggtc
tcgctggtacacgaaatgattaaacgagacgcccgcaaagggctggctacgctctgtatc
ggcggcggtcagggtgtagcgctcgctatcgaaagataa

DBGET integrated database retrieval system