KEGG   Leptotrichia buccalis: Lebu_0673Help
Entry
Lebu_0673         CDS       T00975                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 1
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lba  Leptotrichia buccalis
Pathway
lba00625  Chloroalkane and chloroalkene degradation
lba01100  Metabolic pathways
lba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lebu_0673
   00361 Chlorocyclohexane and chlorobenzene degradation
    Lebu_0673
Enzymes [BR:lba01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Lebu_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Phyto_Pns9_10 PGP_phosphatase Bcr-Abl_Oligo
Motif
Other DBs
NCBI-ProteinID: ACV38581
UniProt: C7N8V0
Position
740901..741620
Genome map
AA seq 239 aa AA seqDB search
MNYKLVLIDLDDTLFDYPKAENSAFRSTFEEMEFFKENRFLKNQNSEEFYTEIKREYEKI
NSQLWKDLEKGIVNKEELKVIRFEKIIKKFKLEYDSQKMSEVYLKKLGEGIFPFKSTEKL
CKYLHSKYKIGIVTNGIKEVQYSRIKNSSISNYIDKIIISDEVGVNKPDKKIFEYAMNYF
EISDKKTVIMIGDSLEADIKGGQNAGIDTCWVNLRNNVNDTGIVPKYEVNKLEKLFEIL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaattataaacttgtattaatagatttggatgatacgctttttgattatccaaaggcg
gaaaattcagcatttaggagtacatttgaagagatggaattttttaaggaaaatagattt
ttgaaaaatcaaaatagtgaagaattttatacagaaattaaaagggaatatgaaaaaata
aattcacagttgtggaaggacttggaaaagggaatagtaaacaaggaagaattaaaagtt
ataagatttgagaaaattattaaaaaatttaagctggaatatgattctcagaaaatgagt
gaagtttatttgaaaaagctgggagaaggaatttttccatttaaatcgactgaaaaatta
tgtaaatatctacattcaaaatacaaaattggaattgtaacaaatggaataaaagaagtt
cagtattctcggataaaaaattcatcaatatcaaattatattgataaaatcattatttca
gatgaagttggagtgaataagcctgataaaaaaatatttgaatatgcaatgaattatttt
gaaatatcagataaaaaaacagttataatgataggtgattctctagaagctgatataaaa
ggcggacaaaatgctgggattgatacttgctgggtaaatttgagaaataatgtgaatgat
acagggattgttccaaagtatgaagtaaataaattggaaaaattatttgaaatattataa

DBGET integrated database retrieval system