KEGG   Leptotrichia buccalis: Lebu_0822Help
Entry
Lebu_0822         CDS       T00975                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lba  Leptotrichia buccalis
Pathway
lba00260  Glycine, serine and threonine metabolism
lba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lba01100  Metabolic pathways
lba01110  Biosynthesis of secondary metabolites
lba01130  Biosynthesis of antibiotics
lba01230  Biosynthesis of amino acids
Module
lba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lebu_0822
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lebu_0822
Enzymes [BR:lba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lebu_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth NMO PcrB
Motif
Other DBs
NCBI-ProteinID: ACV38730
UniProt: C7N999
Position
complement(907688..908461)
Genome map
AA seq 257 aa AA seqDB search
MSEKNLDKKIIDIFREKEKVNIGYIVAGYPSVDFTKQFLQNLDNTALDMLEVGIPYSDPI
ADGKLISQASFLASEAGVTTDTVFDLLTEIKNDISKPLIFLIYYNLIFAYGIDEFIKKCC
EANVKGIIIPDLPYEEAFEMSEKLRENNIALIPLVSVTSGNRMKKIISQGDGFIYAIGSL
GVTGSKQVDLPRLESFINEIREVSDLPVSLGFGIKNNDNVNTMRKYADGVIVGTSIVEFL
EKNDVNYLIQKINELFK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaaatttagataagaaaattattgatatttttagagaaaaagaaaaagta
aacattggttatattgtcgcaggatacccaagcgttgattttacaaaacaatttttacaa
aatttggataatacggctcttgatatgctagaagtcggtatcccctactctgatcccata
gctgacggaaaattgatttcacaagcttcatttctcgcttcagaagctggagttactacc
gataccgtatttgatttactaacagaaataaaaaacgatatttcaaaacctttaattttt
ttaatttattacaacttaatatttgcttatggaattgatgaatttatcaaaaaatgctgt
gaagctaatgttaaaggaataatcattccagacttaccttacgaggaagcctttgaaatg
tcagaaaaactacgagaaaacaatatcgctcttatccctcttgtaagcgttacttctgga
aatagaatgaaaaaaattatctctcaaggtgacggcttcatttacgcaatcggttctctt
ggagttacaggttcaaaacaagttgatttaccacgtttagaatcttttattaatgaaatt
agagaagtttcagacttgccagtttcattaggttttggaataaaaaataacgataacgtg
aatacgatgagaaaatatgcggatggagtgattgtaggaacgagtattgttgaattttta
gagaaaaatgatgtaaattatttgattcagaaaattaatgaactttttaaataa

DBGET integrated database retrieval system