KEGG   Leptotrichia buccalis: Lebu_0825Help
Entry
Lebu_0825         CDS       T00975                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lba  Leptotrichia buccalis
Pathway
lba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lba01100  Metabolic pathways
lba01110  Biosynthesis of secondary metabolites
lba01130  Biosynthesis of antibiotics
lba01230  Biosynthesis of amino acids
Module
lba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lebu_0825
Enzymes [BR:lba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lebu_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACV38733
UniProt: C7N9A2
Position
complement(910480..911205)
Genome map
AA seq 241 aa AA seqDB search
MDILEKIKIKRDIQLEDELKSFKQPSLKKALNQKGIQIIGEIKRASPSKRKIAKDDFDLL
KQAQSYVDKGVSAFSILTEKEYFKGENDFIKIVRQKFPEIPILRKDFIYTPFQVAHAKFL
GASAILLIVRMLDDKTLLELHKLAQDLEMDVLVETHDEEEIRRALKIPNLEILGINNRNL
NTFEVDIRTTEKLINEIPSDVLNNLTIVSESGFLSKEDVEYAEKLNVDGLLIGEALMKGL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggatattttagaaaaaataaaaataaaaagagatatacagcttgaagacgaattaaag
tcttttaagcaaccgtctttaaaaaaggcacttaatcaaaaggggattcagattattggg
gaaattaagagagcttccccatcgaagcgaaaaattgcgaaagatgattttgatttgtta
aaacaggcacaaagttatgtggataaaggagtttccgctttttcgatattgacggaaaag
gaatattttaaaggggagaatgattttataaaaattgtaaggcaaaaatttccagaaatt
ccaattttgagaaaagattttatttatactccgtttcaagtggctcatgctaagtttttg
ggggcttcggcaattttgctgattgtgagaatgctggatgataagacgcttttggaactt
cataagctggcacaggatttggaaatggatgttttggtggaaactcatgacgaagaggaa
ataagaagagctttgaagattccaaatttggaaattttggggataaataaccgaaatttg
aatacttttgaagttgatattagaactacggaaaaactgataaatgaaattccaagcgat
gttttgaacaatttgactattgtaagtgaaagtggatttttgtcaaaagaagatgtagag
tatgcagaaaaattgaacgtggatggactgctaattggggaggcacttatgaaagggctt
ctttaa

DBGET integrated database retrieval system