KEGG   Leptotrichia buccalis: Lebu_0967
Entry
Lebu_0967         CDS       T00975                                 
Name
(GenBank) hypothetical protein
Organism
lba  Leptotrichia buccalis
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACV38869
UniProt: C7N9N8
Position
complement(1057336..1057575)
AA seq 79 aa
MKLKVYKSLLDVKMIMGLPYKIFISLVLFTGIIFLIFRHWIIFIPAGTIYILCAVMSVRD
SMTLELIMEHYKTERYLNP
NT seq 240 nt   +upstreamnt  +downstreamnt
atgaagctgaaggtttataagtctttactggatgtaaagatgataatgggactgccatat
aaaatttttatatcgctagtgttattcacaggaatcatatttttaatattcaggcattgg
ataatttttataccagcaggaacaatatatattctgtgtgcagttatgtcagtaagggat
tcaatgacattggaactgataatggagcattataaaactgaaagatatttaaatccttaa

DBGET integrated database retrieval system