KEGG   Leptotrichia buccalis: Lebu_0970
Entry
Lebu_0970         CDS       T00975                                 
Name
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
lba  Leptotrichia buccalis
Pathway
lba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Lebu_0970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lba02044]
    Lebu_0970
Enzymes [BR:lba01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Lebu_0970
Secretion system [BR:lba02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Lebu_0970
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACV38872
UniProt: C7N9P1
Position
complement(1058861..1060891)
AA seq 676 aa
MDKKYKPLKNTKPVKWIFSIIMFILVNITGLMVISTNYMEELEKVNNYATFAKIRRLIKP
VIIGKKNQYMYFPSGNWEMIMKKTPRLTSQFQLGICSLLVGSLIILTMPYWKKKKLKSHG
EAEFGTYDDLKKNKKKPSDVDFLSGNENGFVIGYVKTLSGKLKLLYDTSMIHIALFLPTR
GGKGVGYIIPSLVAGLKKRSTFISDIKKENYELTSWYRAKILKHRILKFEPMSELSNSYN
FLSEVRYGTNYEIEDCRIIGTMIVGEDESKDPFWGDSAKDTISTLTGYVHYREVSNRPEE
DPDITDVRVSLNDVISIITNTENSLYRMFAKYLGKPMEEDEYEDEMSKDFILKKKTVERL
RKIYTDDESIKALNKGLHPFVAKQFGYLLQNTGENTFKSITSTAKTKLQVFEIPSVVKNI
GKSDFRALDLVNSDKPVDLYFVIKPKDIDLLAPLVRIMYIQLTNLLMESLSKKNFNIIFL
MDELNAYGRMKPLVKGLGYYAGFGIKMVGIFQGLDQLNSTYDKQGKEVLNGCQIQVFGRP
NDEAAPDYISKTLGKETIRVKSRNIGLKGGGNVSEQGKDLLSPSEIRLLPDRKAVVITGY
KKPLLLDKLYYYEYPELLKRTQHQPVFFKDGYVIFEAMKGMYEYEHTFRMKEEDFYDDIK
YEKIIEKARKKYKSEK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggataaaaaatacaagccgcttaaaaatacgaagcctgtaaaatggattttttcaata
ataatgttcattttggtaaatataacaggtttaatggtaatatcaacaaactatatggaa
gaactggaaaaagttaataactatgcaacttttgcaaaaatacgtagattaataaaacca
gtaattattgggaaaaagaatcagtatatgtattttccatctggaaattgggaaatgata
atgaaaaaaactcctagattaacttcacagtttcagttaggtatatgctctcttttggtt
ggatcattaattattctaacaatgccatactggaaaaaaaagaaactaaaatcacacgga
gaagctgaatttggaacatatgatgatttgaagaaaaataagaaaaaaccgtcagatgta
gattttttaagcggcaatgaaaatggttttgttattggatatgtaaaaactttatcaggg
aaattaaaattgctttatgatacgtcaatgatacatattgccctatttttgccaacaaga
ggaggaaagggtgtaggatacattattccaagccttgttgcaggattaaaaaaaaggtca
acttttatttctgacataaaaaaggaaaattacgaacttacaagttggtacagagcaaag
atactaaaacatagaatattaaaatttgaaccaatgagtgaactttcaaatagctataac
tttttatcagaagtaagatatggaacaaattatgagattgaagattgcagaataattgga
acaatgattgttggggaagatgagagcaaggatccgttttggggagacagtgcaaaagat
acaatttctactttaactggttatgttcattacagagaagtaagcaatcgtcctgaagaa
gatcctgatataacagatgttagagtttcactaaacgatgtaatatcaataatcactaat
actgaaaattctttgtatagaatgtttgcaaaatatcttggaaagcctatggaagaagat
gaatacgaggatgaaatgtcaaaagattttattctaaagaaaaaaacagttgaaaggctt
aggaaaatatatactgatgatgaatcaattaaagcattaaacaaaggattgcaccccttt
gttgcaaaacagtttggatatttattacaaaatacaggagaaaatacatttaagtctatc
acatcaacagcaaagactaaattacaggtatttgaaattccttcggtcgtaaaaaatata
ggaaagtctgattttagggcattggacttggttaatagtgataagcctgtggatttatat
tttgtaataaaaccaaaagatatagatttattagctccattagtacggataatgtatatt
cagctgacaaatttattaatggaaagtttaagcaagaaaaatttcaacataatattttta
atggatgaactgaatgcttatggcaggatgaaacctcttgtaaaaggcttgggatactat
gcaggatttggaataaagatggttggaatatttcagggacttgatcagttaaattcaaca
tacgataaacaggggaaagaggtgttgaatggatgtcaaattcaagtatttggtagacca
aacgatgaagctgcgcctgactatatttcaaagacacttggtaaagaaacaatcagggta
aaaagtagaaatattgggctaaaagggggaggaaatgtttcagagcagggaaaggattta
ttaagtccttcagaaataagactgctgcctgacagaaaagcagttgtaattacgggatat
aaaaaacctttattattagataagctctattactacgaatatcctgaactgttaaaaaga
acgcagcaccagccagtattttttaaagatggatatgtaatatttgaagcaatgaagggg
atgtatgaatatgagcatacatttaggatgaaagaagaagatttttacgatgatataaaa
tatgaaaaaattattgaaaaggcaagaaaaaagtataaatcagaaaaatag

DBGET integrated database retrieval system