KEGG   Leptotrichia buccalis: Lebu_0971
Entry
Lebu_0971         CDS       T00975                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
lba  Leptotrichia buccalis
Pathway
lba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lebu_0971
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lba02044]
    Lebu_0971
Secretion system [BR:lba02044]
 Type IV secretion system
  Trb secretion system protein
   Lebu_0971
SSDB
Motif
Pfam: TrbI UPF0154 CECR6_TMEM121
Other DBs
NCBI-ProteinID: ACV38873
UniProt: C7N9P2
Position
complement(1060894..1062243)
AA seq 449 aa
MINKNDYFETSEDDFTEQKEEEISLEDEGNGTIKNSKITIEEFFDKKKVIILICIISGLI
FASIYFANQVKKNMKSNEQEKVDSISTGTELDINDAVNTQANKNPQVSETIAQSGTENIN
TASDKTGTPNLSQYDSQLGSDYNNDNFDSSYGASTSPPSFSNVSENENTNTSATSVAPSE
KYKEWRKSSIGFDKGVSTQTPQVPEQYQEQQPASQNTQQQNENDTDQNKQKSKSLFLKQK
QDSFYSTNLKNPAIGKYELKTGSFIPAVLVTAINSDLPGDVIAQVRENVYDYRTGKNILI
PMGTKIIGKYDSSITYGQNRVLLIWQRLVFPNGSTLVLDNMQGVDLLGNAGLKGKTNNHF
WKLMRSVLLSSAINIASGSLEGLNVNIETGSRSRVNIGTGVSDAAQNIRSIGERIIEKDL
NRQPTIEIKRGKKFNIFVSKDIILSPYRK
NT seq 1350 nt   +upstreamnt  +downstreamnt
ttgataaataaaaatgactattttgaaacttctgaagacgattttacggagcagaaggaa
gaggaaatatcgcttgaagatgaaggaaacggaacaataaaaaattcaaaaataacaata
gaagaattttttgataagaaaaaagtcattattctaatttgtataatttcaggcttaatt
tttgcaagcatatattttgcaaatcaggtaaaaaaaaatatgaagtcaaatgaacaggaa
aaagtagattcaatatcgacaggaacggaactggatataaatgatgccgtaaatactcag
gcaaataaaaatcctcaagtttctgaaaccatagcacagtctggaacagaaaatataaat
acagcatctgataaaacgggaacgccaaacttatcacaatatgattctcaattaggttca
gattacaataacgataattttgattcaagttatggagcttcaacttctcctccatcattt
tctaatgtttctgaaaatgaaaatactaatacttcagctacttctgtagctccttcagag
aaatataaggaatggagaaaatcctcaataggatttgataaaggagtttcaacacaaact
ccacaagtaccagaacaatatcaggaacagcaaccagcttcacaaaatacacaacagcaa
aatgaaaatgacacagatcagaataaacaaaagtcaaagtccttattcctgaaacaaaaa
caggacagcttctattcgactaatttaaaaaatcctgcaatagggaaatatgagttaaag
acagggagctttattccagccgttcttgtaacagcaattaattctgatttaccgggagat
gtgattgctcaagttagagaaaatgtctatgactaccgtactggaaaaaatattttgatt
cctatgggtacaaaaataattgggaaatatgatagcagtataacgtatggacagaataga
gttttattgatatggcaaagactagtatttccaaatggctcaacacttgtgcttgataat
atgcagggagttgatttgttaggtaatgcaggattgaaaggaaaaactaacaaccatttc
tggaaacttatgagaagtgtgttactatcctctgctataaatatagcttcaggatcactt
gaaggtctaaatgtaaatattgagactggaagcaggtcaagagtgaatattggtacaggt
gtttcagatgctgcacagaatattagaagtatcggtgaaagaatcattgaaaaagattta
aacagacagcctacaattgaaataaagagaggtaaaaaatttaatatctttgtaagcaag
gatataattttatctccatataggaaataa

DBGET integrated database retrieval system