KEGG   Leptotrichia buccalis: Lebu_0972Help
Entry
Lebu_0972         CDS       T00975                                 

Definition
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
lba  Leptotrichia buccalis
Pathway
lba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lebu_0972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lba02044]
    Lebu_0972
Secretion system [BR:lba02044]
 Type IV secretion system
  Trb secretion system protein
   Lebu_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACV38874
UniProt: C7N9P3
Position
complement(1062260..1063084)
Genome map
AA seq 274 aa AA seqDB search
MTGNKLKKINKRILSILFLTLISANIFANDGNAKNDITVDTVKNNQRLFDDDGILSGKKE
AIKKTSVVFNYSENSIYEVYSKPDYLTTLRLAPNEKVIFKAGGDTERWMIEEAVGGKENR
TYIYIKPLEEDIKTNINIVTDKHSYFINIESKNGEYNPLVEWQYPNERKILMNEYEDNSE
AIGTTDLMKLNYRYFWNKNSKLSPVQVFDNGKKTFIVLKANLQEMPAFYVKGLDNQLSLV
NTKIEGRNVMINSVVKEIHMTLGKKTLKIYNRKK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaacaagttaaagaaaattaataaaagaatactctcaatattgtttttgaca
ttgatatcagcgaatatttttgcaaatgatggaaatgcaaaaaatgatattacagtagat
acagtaaaaaataatcaaaggctgtttgatgatgatggaatattaagtgggaagaaagag
gcgataaaaaagacatctgttgtattcaattattctgaaaacagtatatatgaagtttat
tctaaaccagactatttaacaactttaaggctagctccaaatgaaaaagtaatatttaag
gctggtggagatacagaacgctggatgattgaagaagctgtaggtggaaaagaaaataga
acatacatatacataaaaccacttgaagaagatatcaagactaatataaatatagtaacg
gataaacacagttattttattaatattgaatctaaaaatggagaatacaatcctttagtg
gaatggcaatatccaaatgaaagaaaaatattgatgaatgagtatgaagataattcagaa
gctattggtacaacggacttgatgaagcttaattatagatatttttggaacaaaaattct
aaactttcaccagttcaggtatttgataatggaaaaaaaacgtttatagtgttgaaggca
aatttacaagaaatgccagctttttatgttaaagggttagataatcaactgtctttagtt
aacacgaaaattgaggggcgtaacgttatgattaatagtgttgtaaaggaaatacacatg
acacttgggaaaaaaacattaaaaatatataaccgaaaaaaataa

DBGET integrated database retrieval system