KEGG   Leptotrichia buccalis: Lebu_1889Help
Entry
Lebu_1889         CDS       T00975                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lba  Leptotrichia buccalis
Pathway
lba00230  Purine metabolism
lba01100  Metabolic pathways
Module
lba_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lebu_1889
Enzymes [BR:lba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lebu_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 Cytidylate_kin AAA_16 Thymidylate_kin dNK PRK KTI12 AAA_28 Zeta_toxin AAA_17 MMR_HSR1 T2SSE AAA_5 AAA NTPase_1 ABC_tran AAA_29 RNA_helicase RsgA_GTPase APS_kinase AAA_14 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACV39754
UniProt: C7NC73
Position
complement(1997141..1997686)
Genome map
AA seq 181 aa AA seqDB search
MKGKLIIVSGPSGSGKSTVTKLVKDRLNIPLSISATTRQPRTGEINGKDYFFLTKEIFEQ
KIKNDEFYEYANVHGNYYGTLKEVVENNLSKGLNVILEIDVQGALIAKEKKKDAILVFFR
TKDMETLENRLRNRKTDTEEVIQLRLKNAAKELEYEPKYDYTIINNDIKHSCQELIDIIN
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaattgattattgtttcaggaccatcaggttcaggaaaatcaacagtcaca
aaattagtaaaagatagattaaatatcccattatcgatatcagcaacaactcgacagcca
agaaccggagaaatcaacggaaaagattacttttttttaactaaggaaatatttgaacaa
aaaataaaaaacgatgaattttatgaatatgcaaatgttcacggaaattattatggaaca
ttgaaagaggttgtggaaaacaacttaagcaaaggattaaatgtaattctggaaattgat
gtacaaggtgcattaattgcgaaagaaaagaaaaaggatgctattcttgtgttttttaga
acaaaggatatggaaacgctggaaaataggcttcgtaacaggaaaactgatacggaagaa
gttattcagctacgtttgaaaaatgcagcaaaagagctggaatatgaaccaaaatatgat
tacactataataaataatgacattaagcattcttgccaagaattgatagatattattaat
tcataa

DBGET integrated database retrieval system