KEGG   Leptotrichia buccalis: Lebu_2109Help
Entry
Lebu_2109         CDS       T00975                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lba  Leptotrichia buccalis
Pathway
lba00770  Pantothenate and CoA biosynthesis
lba01100  Metabolic pathways
Module
lba_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Lebu_2109
Enzymes [BR:lba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Lebu_2109
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Lebu_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein EutB DUF166 IMPDH Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACV39968
UniProt: C7ND90
Position
2252727..2253935
Genome map
AA seq 402 aa AA seqDB search
MKNILVGVTGGIAAYKSAGIVSLLKKKGYNVKVVMTENATKIIGPLTLETLSRNRIYVDM
WDSNPHYEVEHISLADWADVVLIAPATYNIIGKVANGIADDMLTTILSAVSVRKPVFFAL
AMNVNMYENPILKENIDKLKSFGYRFIDAEEGLLACNYSAKGRMSEPENIVDEIERYSIF
SKFENFDIVLKNKKILITSGRTKENIDPVRYLSNNSSGKMGYSLAQAAVDLGAEVTLISG
PTNLKVPNGLEKFIFVESALEMYEKVDEYFKNTDIFIACAAVADYRPKEYKKEKIKKSDS
DFVIELVRNPDILLEMSKKKEKQLLVGFAAETNEIRENALKKLEKKNLDIIVANNASVMG
SDENVIEIIKKDRTSVEISQKSKVELAYDILSEVIFELEKRY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattttagtaggagttacagggggaattgcggcatataaatcggctggaatt
gtatcgcttttgaaaaagaaaggatataatgtgaaagttgtgatgactgaaaatgctaca
aaaatcattggacctttgactcttgaaactttatcaagaaataggatttatgtggatatg
tgggatagtaatccgcattatgaagtggagcatatttcacttgcggattgggcggatgtg
gttttgattgcacctgcgacttataatataattggaaaagttgcaaatgggattgcagac
gatatgcttacgacaatcctttctgctgtttcggtaagaaagccagtattttttgctttg
gcaatgaatgtgaatatgtatgaaaatccgattttaaaagagaatattgataaactgaaa
tcttttggttataggtttattgatgcagaagaaggattacttgcttgcaattatagtgcg
aaggggagaatgagcgagccagaaaatattgtcgatgaaatagaaagatacagtattttt
tcaaaatttgagaattttgatatagtcttgaaaaataagaaaattcttataacaagcgga
agaacaaaggaaaatattgatcctgtcagatatttgtcaaataattcaagtggaaaaatg
ggatattcacttgctcaggcggctgttgatttgggagcagaagtaactttaattagtggg
cctacgaatttgaaagttccaaatggacttgaaaaatttatttttgtagaatcggcattg
gaaatgtatgagaaagtggatgaatattttaaaaatactgatattttcatagcttgtgcg
gcagttgctgattacagaccaaaggaatacaaaaaggaaaaaataaagaaatctgactca
gattttgttatagaattggttagaaatcctgatattttattagagatgagtaagaagaag
gaaaaacagctattagttggatttgccgcagaaactaatgagataagggaaaatgcctta
aaaaagctggaaaagaaaaatttggatattatagtagcaaataatgcgtctgtaatgggc
agcgatgaaaatgtgattgagattattaaaaaagataggacttcggtggaaattagtcag
aaaagtaaggtggagctggcttatgatattttgagtgaagttatttttgaattggaaaag
agatactaa

DBGET integrated database retrieval system