KEGG   Leptotrichia buccalis: Lebu_2280Help
Entry
Lebu_2280         CDS       T00975                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lba  Leptotrichia buccalis
Pathway
lba00620  Pyruvate metabolism
lba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lebu_2280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lba02000]
    Lebu_2280
Enzymes [BR:lba01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Lebu_2280
Transporters [BR:lba02000]
 Other transporters
  Primary active transporters [TC:3]
   Lebu_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA MPLKIP
Motif
Other DBs
NCBI-ProteinID: ACV40131
UniProt: C7NED9
Position
complement(2434664..2436043)
Genome map
AA seq 459 aa AA seqDB search
MSKVKITETSLRDGHQSLMATRMTTAEMLPIIETMDKAGYHAMEVWGGATYDAAIRFLNE
DPWERLREIRKRTKNTKLQMLLRGQNLLGYRHYADDIVDKFVELSIKNGIDIIRIFDALN
DTRNIRQASESTKKYGGHSQLAICYTISPVHTIEYYKKLALEMQDMGADSIAIKDMSGIL
LPNMAYELVTELKAILSVPLELHTHATAGLAGMTTLKAIEAGVDIVDTAISPFGGGTSQP
PTESLVRTLQGSKYDTELNLEVLKEVAEYFKPIRKKYIDNGTLNPKALLIEPNIIEYQLP
GGMLSNLLSQLKVQEAEDKYEDVLREIPHVRKDLGYPPLVTPMSQMVGAQAVLNILTGRK
YQMIPKEIRDYVKGMYGKSPVPIIDETRKLIIGDDEVFNGRPADLLGAEYENMKNEIGDL
AKCDEDILTYACFPQVARDYLERKYSEKEVEIQDINGFF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtaaaaataacagaaacatcattaagagatggacatcaatcacttatggca
acaagaatgacaacagcagaaatgcttccaataattgaaactatggacaaagctggatat
cacgcaatggaagtctggggcggtgcaacatatgatgcggcaatcagatttttgaatgag
gatccttgggaaagattaagagaaattagaaaaagaactaaaaatacaaaattacaaatg
ctacttagaggacagaatttattaggatatcgacattatgctgacgatattgtagataaa
tttgtagaactttcaataaaaaatggtattgatattataagaatttttgatgctttgaat
gatacaagaaatattagacaagcttcagaaagtacaaaaaaatatggtggacatagccaa
cttgcgatttgctatacaataagccctgttcacacaatagaatattacaaaaaattggca
cttgaaatgcaggatatgggtgcagattcaatagcaataaaggatatgtctggaattttg
ttaccaaatatggcttatgagctggtaactgaattaaaagctattctgagcgtacctctt
gaattacatactcacgcaacggcagggctggctggaatgactacactaaaagcgattgaa
gcgggagtagacattgtagatactgctatttccccatttggaggaggaacatcacagcca
cctacagaatcgcttgtaagaacgttacaaggctcaaaatatgatacagaattaaatctt
gaggttttgaaggaagttgctgaatattttaaacctataagaaaaaaatacattgataac
ggaacattaaatccaaaagccttgttaattgaaccaaatattatagagtaccagttacca
ggaggaatgctctcaaacttgctgtctcaattgaaagtgcaggaggcagaggataaatat
gaagatgttttacgtgaaattccacatgtgcgtaaagatttaggataccctccgttagtt
actccaatgagccagatggttggagctcaggcagtcttaaatattttgacaggcagaaaa
taccagatgattccaaaggaaataagagattatgtaaaaggaatgtatggaaaatcacca
gttccaattattgacgaaactagaaagcttataattggagatgacgaagtatttaatggt
cgtcctgctgatttactaggagctgaatatgaaaatatgaaaaacgaaatcggcgacttg
gcaaaatgcgatgaagatatattaacttatgcgtgtttcccacaagttgcaagagattac
ctagaaagaaaatatagtgaaaaggaggtggaaattcaagacattaatggatttttttaa

DBGET integrated database retrieval system