KEGG   Laccaria bicolor: LACBIDRAFT_187188Help
Entry
LACBIDRAFT_187188 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lbc  Laccaria bicolor
Pathway
lbc04011  MAPK signaling pathway - yeast
lbc04139  Mitophagy - yeast
lbc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LACBIDRAFT_187188
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    LACBIDRAFT_187188
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LACBIDRAFT_187188
  Infectious diseases
   05163 Human cytomegalovirus infection
    LACBIDRAFT_187188
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LACBIDRAFT_187188
Protein kinases [BR:lbc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   LACBIDRAFT_187188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 6069867
NCBI-ProteinID: XP_001873516
JGI: 187188
UniProt: B0CNH6
AA seq 374 aa AA seqDB search
MSFVKLSIFGTSFEVTTRYVDLQPVGMGAFGLVCSSKDQLTGASVAIKKIMKPFSTPVLS
KRTYRELKLLKHIQHENIISLSDVFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETI
CSENTLRFVQSLPKRERIPFSQKLRTADPDAIDLLEKMLVFDPRKRIDATQSLGHEYVSP
YHDPTDEPVAAEKFDWSFNDADLPVDTWKVMMYSEILDFHQVGEASITASGIPGGALAGP
DNGTLQANGIVLTA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtcaaactcagcatctttggaacttccttcgaggtcacaacaagatatgtc
gatctccaaccagttggaatgggtgcatttgggctcgtctgttcgagcaaggaccaactt
acgggcgcgtctgtggcgatcaagaagatcatgaagccattcagcacaccagtgctgagc
aaaagaacgtaccgggagctcaagcttctcaagcacatccaacatgaaaatattatcagc
ctcagcgatgtcttcatttctccccttgaggatctatactttgtgaccgaactcctcgga
actgacttacatcgactgctcacatctcgaccgctggagaaacagttcatccagtatttc
ctttaccaaattctgcgtggtctcaagtatgtgcactcagctggtgtggttcatcgtgac
cttaaaccgagcaacattcttgtaaacgagaactgtgatttgaagatctgcgattttggt
cttgcgcgcattcaggaccctcaaatgaccggctatgtctccacacgatattatcgcgcc
ccagaaatcatgttgacatggcaaaagtatgatgtcgccgtcgatatctggagtactggt
tgcattttcgcagagatgcttgagggcaaacccctcttcccaggcaaagatcacgttaat
cagttttcgatcatcacggaattattgggtacaccgcccgatgatgtcatcgaaaccata
tgcagcgaaaatacgcttcgatttgtccaaagcctgccaaaacgtgaacgcattcccttc
agtcagaagctacgcacagcggatcctgatgccattgaccttcttgagaagatgctggtg
ttcgatccccggaaacgtatagatgccacccaatcgctagggcatgaatacgtttcgccg
tatcacgatcccaccgatgaacccgtcgccgcagaaaagtttgactggagtttcaatgat
gctgatctcccagtggacacatggaaagtcatgatgtacagtgaaattttggacttccac
caagtaggcgaagcatcgatcacggcgagcggaattccagggggtgctctagctgggcca
gataatggcactctccaagcaaacgggatcgttcttactgcatga

DBGET integrated database retrieval system