KEGG   Laccaria bicolor: LACBIDRAFT_188009Help
Entry
LACBIDRAFT_188009 CDS       T01044                                 

Definition
(RefSeq) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lbc  Laccaria bicolor
Pathway
lbc00250  Alanine, aspartate and glutamate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACBIDRAFT_188009
Enzymes [BR:lbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LACBIDRAFT_188009
Peptidases [BR:lbc01002]
 Cysteine Peptidases
  Family C44
   LACBIDRAFT_188009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase
Motif
Other DBs
NCBI-GeneID: 6071048
NCBI-ProteinID: XP_001875360
JGI: 188009
UniProt: B0CS83
AA seq 586 aa AA seqDB search
MCGILAVHGLEKPSTDRAHFIALSKRLRHRGPDWSGCYVGKNSILVHERLAIVGVDTGAQ
PLISEDGKIILAVNGEIYNHIALRATVGPDVKFKTNSDCEVIIPLYQQHGTELCGHLDGM
FSFVLLDESVSPSRIIAARDPIGITTLYQGWSSKRPGSVYFASELKALVDECDRIISFPP
GHVYDSKYDSTTRYYQPTWWDGDAQGPDFTIPTTPANLTSIREALEEAVRKRLMSEVPYG
VLLSGGLDSSLIAAIAARETEKVAQAQYEVRRRKLQEYSNGPPTMLAAWPHLHSFSIGLE
NSPDLLAARKAAHFLGTVHHEYVFTVQEGIDAIPEVIYHLETYDVTTVRASTPMYLLSRK
IKAMGVKMVLSGEGSDEIFGGYLYFHAAPDENSFHQECVRRVKNLHTADCLRANKSTMAW
GLEARVPFLDKAFLEVAMNIAPKGKMFHKGAQQEVDEDGCPKMEKYLLRKAFDLSPDGKP
YLPQSILWRQKEQFSDGVGYSWIDGIKNYAAEVVSDEAFAKRAEKWTTDVPDTKEAYFIR
DIFDGLFPSEAAAKTAVRWIPRGDWGCASDPSGRSVSIHNAAYETD
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatattggctgttcatggcctagaaaaaccttccaccgacagagcccacttc
atcgccctgtctaaaagacttcgccaccgtggccccgattggtctggctgctatgtgggc
aagaacagcattctagtccatgagcgccttgcgattgtcggcgttgataccggtgctcag
ccgttaattagcgaagacggtaaaattatacttgcagtgaatggagagatctacaaccac
atcgcgctccgagcgaccgttggtccagatgtaaagttcaaaacgaactccgattgcgag
gtcattatcccactgtaccaacaacacggtacggaactatgcggacatctggatggaatg
ttctcatttgtcctcctcgatgagtctgtttcaccgtcccgcattattgctgcgcgagac
cctatcggcataacgacattataccaaggctggagctcaaagcgaccaggctctgtttac
ttcgcgtctgaattgaaggcgttggttgatgagtgcgatcgcatcatttccttccctccc
ggtcacgtatacgacagcaaatatgattccacaacacgttactaccagccgacctggtgg
gacggcgatgcccaaggcccagatttcaccattcctaccacacccgccaacttgacatcg
atccgcgaggccctggaagaagcagtacgaaaaaggcttatgtcggaggttccatacggt
gttttgcttagtggtggcctcgatagtagtttgattgcggccatagccgcgagagaaacg
gaaaaggtggcacaggcccaatacgaggtgcggaggagaaagcttcaagaatattctaat
gggccaccgacaatgctggctgcctggccacatctgcactcgttctccatcggacttgag
aactcccctgatcttctagcggccaggaaggcagcgcatttccttggaacagtgcatcac
gagtatgtttttacagttcaagagggtatagatgccattcccgaagtaatttatcacctc
gagacctacgatgtcaccaccgtccgagccagcacacccatgtatctcctgagtcgaaaa
atcaaggctatgggtgtcaaaatggttttgagtggagaaggaagcgacgagatttttgga
ggctatctttacttccacgctgctcccgatgaaaactcgttccaccaagaatgtgtgcga
cgcgtcaaaaacttgcacactgctgactgcttaagagcgaacaaatccacaatggcctgg
gggctggaggcacgcgtgccttttctcgataaagcttttcttgaagtcgcaatgaacatt
gctccaaaaggaaaaatgttccataaaggagctcagcaggaggtggacgaagacggatgc
cccaagatggagaagtatctccttagaaaagcatttgatctttcccccgacggcaagcct
tacctaccacaatcaattctctggcgtcaaaaggaacaattttctgatggcgttggctat
tcttggatcgacgggatcaagaactatgcagctgaagttgttagcgacgaagcatttgca
aaacgggcggaaaaatggacaacggatgtccccgatactaaagaagcgtacttcattcgt
gatatcttcgacggattattcccatcagaagctgcggccaagacagccgttcgctggatt
cctcgtggcgactggggatgtgcatcggatcccagcggccgaagtgtcagcatacacaat
gcggcatacgaaacagattga

DBGET integrated database retrieval system