KEGG   Laccaria bicolor: LACBIDRAFT_192627Help
Entry
LACBIDRAFT_192627 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
lbc  Laccaria bicolor
Pathway
lbc00062  Fatty acid elongation
lbc01040  Biosynthesis of unsaturated fatty acids
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    LACBIDRAFT_192627
   01040 Biosynthesis of unsaturated fatty acids
    LACBIDRAFT_192627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lbc01004]
    LACBIDRAFT_192627
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     LACBIDRAFT_192627
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     LACBIDRAFT_192627
Lipid biosynthesis proteins [BR:lbc01004]
 Fatty acid synthase
  Component type
   LACBIDRAFT_192627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR NmrA NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 6076163
NCBI-ProteinID: XP_001880429
JGI: 192627
UniProt: B0D8R3
AA seq 338 aa AA seqDB search
MDVFNVQELSFSLVRDQPYLSAFLLVMGSIGVGRVIYQTLSVFLQTFILPGTNLRKFGAK
KGAWAVVTGATDGIGREFSLQLAKAGFHVFLVARNEALLASTAAEIEQKYGVSTATHSID
FSKADKSAYNSLGSSLGSVDVGVLVNNVGKSHAMPAYFVDTPEEEMSDIVSINVQATLQV
THSVLPGMVQRKRGLILNVGSFAGAVPSPMLATYSGTKAFLTTFSSALGEEVRKDNITVE
HLNTYFVVSKLSKIRKASALIPKPDAYVRSVLSKIGLPCGASYSGRPNTSTPFWSHALLD
YGLTLIGLQSAFISYTHGLHKDIRRRALRKMERDAKLQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcaatgtacaggaactctccttttctctcgtccgtgatcaaccttacctg
tctgccttcctcctcgtgatgggatccattggtgttggtcgcgtcatctaccaaaccctt
tcagtttttctgcagacatttatcctaccgggaacgaacctcaggaagtttggcgcgaag
aagggtgcttgggctgtcgtcacaggagcgactgatggtattggcagggaattctcgctt
cagttggcaaaagcgggcttccacgttttcctcgttgctagaaacgaggcactgcttgcg
tctacggctgcggaaatagaacaaaaatatggagtatctactgcaacgcactccatcgac
ttttcaaaggctgataaatcagcctacaattctctcggaagttccctcggcagtgtagac
gtcggtgtcttggtgaacaacgttgggaaatcccatgctatgcccgcttattttgtggat
actcccgaggaggagatgtccgatattgtgtcaatcaatgtgcaggcgactctgcaggtt
acccactcggtcctgcccggcatggttcagcgaaaacgcgggttgattcttaacgttgga
tcgtttgcgggtgctgtgccatcgcccatgcttgcaacatattcagggaccaaagcgttc
ctcactacgttctcaagtgcgttaggcgaggaggtcagaaaggacaacattactgtcgaa
catttgaacacctattttgttgtgtcgaagctctccaagatccgcaaagcgtcggccctc
atacctaaaccagatgcctatgttcgttctgtattgtcaaagatcggtctgccgtgtggt
gctagctacagtggtcgaccgaacacgtcaactccgttctggtcacacgcgcttctggac
tacggcctgacgttgattgggcttcagagtgcattcatcagttatacgcacggccttcac
aaggatatcagacggcgtgcgctgcgaaagatggagagagatgcgaagttacagtga

DBGET integrated database retrieval system