KEGG   Laccaria bicolor: LACBIDRAFT_228028Help
Entry
LACBIDRAFT_228028 CDS       T01044                                 

Gene name
MCR1.2
Definition
(RefSeq) NADH-cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lbc  Laccaria bicolor
Pathway
lbc00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LACBIDRAFT_228028 (MCR1.2)
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LACBIDRAFT_228028 (MCR1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 6069351
NCBI-ProteinID: XP_001874137
JGI: 228028
UniProt: B0CNH5
AA seq 272 aa AA seqDB search
EQFIDFKLKKTEPYNHNTSKYVYCTSILPKDEASLIPVASCLVVKSSDPETLKDAKGKPI
IRPYTPISGPDVKGELTLLVKRYENGNASKHIFNLKKGDTLAMKGPIAKFPYKANEFEEV
ALIGGGSGITPLYQILNHALPDKNNKTKFTLLFSNVTEQDILLREEFDALKQKYPKKFDV
VYILDKPSETWTGPTGYISSEIVKQHVPPATLGDKVKVFVCGPPPQVASLAGKKAGMKQG
ELGGILKELGYTEDQVCYFFLPPLLSSNATSC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gagcagttcatcgactttaaactgaagaaaactgaaccatacaaccacaatacatccaag
tatgtttattgtacgagcatcctgcccaaagatgaagcttctttgatccccgtcgcgtcg
tgtctggttgtgaagagctctgacccagagaccttgaaggatgccaaaggcaaacccatc
atccgtccctacactcccatctccggacccgatgttaagggtgaactcactctcctcgtt
aaacgctacgagaacgggaacgcctcaaaacatattttcaacctcaaaaaaggtgatacc
ctggcgatgaagggccccatcgccaagttcccttacaaagctaatgaattcgaggaagtt
gcattgatcggcggaggcagcggaatcacccctctttaccaaatcctaaatcacgctctc
ccggacaagaataacaagactaaattcacgctcctgttctccaacgtgactgaacaagat
atcctcctccgtgaagagttcgacgcgctgaagcagaagtaccccaagaagtttgacgtt
gtatacattcttgacaagcctagcgagacctggactgggcctactgggtacatttcctcg
gagattgtcaagcaacacgtcccacccgcaacgctcggtgacaaagtcaaggtctttgtc
tgtggccccccaccacaagtggcctcgctcgccggaaagaaagccggtatgaagcaaggt
gaacttggcggtatcctcaaggaactgggatataccgaagatcaggtctgttatttcttt
ctcccaccactcttaagttccaacgcaacatcttgctga

DBGET integrated database retrieval system