KEGG   Laccaria bicolor: LACBIDRAFT_232872Help
Entry
LACBIDRAFT_232872 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K02260  cytochrome c oxidase assembly protein subunit 17
Organism
lbc  Laccaria bicolor
Pathway
lbc00190  Oxidative phosphorylation
lbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LACBIDRAFT_232872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lbc03029]
    LACBIDRAFT_232872
Mitochondrial biogenesis [BR:lbc03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    LACBIDRAFT_232872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX17 RRM_1
Motif
Other DBs
NCBI-GeneID: 6073709
NCBI-ProteinID: XP_001878167
JGI: 232872
UniProt: B0D374
AA seq 62 aa AA seqDB search
DPTNPKMNPLNPKGLKPCCACPQTKSARDDCFLRFDTTEANEKCKEQVQAHLACMRGLGF
KI
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
gacccgaccaacccgaagatgaaccctttgaacccaaaaggattaaaaccatgctgcgct
tgtccacagacaaagtctgcaagggacgattgcttcctccgatttgacacgaccgaagcg
aacgagaagtgcaaggagcaggtccaggcccatcttgcctgtatgcgcggcctgggattc
aagatctga

DBGET integrated database retrieval system