KEGG   Laccaria bicolor: LACBIDRAFT_234621Help
Entry
LACBIDRAFT_234621 CDS       T01044                                 

Gene name
ECH-3
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbc  Laccaria bicolor
Pathway
lbc00062  Fatty acid elongation
lbc00071  Fatty acid degradation
lbc00280  Valine, leucine and isoleucine degradation
lbc00310  Lysine degradation
lbc00380  Tryptophan metabolism
lbc00410  beta-Alanine metabolism
lbc00640  Propanoate metabolism
lbc00650  Butanoate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
lbc01212  Fatty acid metabolism
Module
lbc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LACBIDRAFT_234621 (ECH-3)
   00650 Butanoate metabolism
    LACBIDRAFT_234621 (ECH-3)
  Lipid metabolism
   00062 Fatty acid elongation
    LACBIDRAFT_234621 (ECH-3)
   00071 Fatty acid degradation
    LACBIDRAFT_234621 (ECH-3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LACBIDRAFT_234621 (ECH-3)
   00310 Lysine degradation
    LACBIDRAFT_234621 (ECH-3)
   00380 Tryptophan metabolism
    LACBIDRAFT_234621 (ECH-3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LACBIDRAFT_234621 (ECH-3)
Enzymes [BR:lbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LACBIDRAFT_234621 (ECH-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 6075768
NCBI-ProteinID: XP_001880444
JGI: 234621
UniProt: B0D8U0
AA seq 285 aa AA seqDB search
MAFRSVLKPRLNFSPVRLMSTSQRQYNFILVSRPEPSVVLVTLNRPKALNALSSPLFQEL
NQALEEADKDDTVGAMVLTGSEKAFAAGADIKEMKDKQCKFSNVFKNKFLENWGEIASLR
KPVIAAVSGFALGGGCELALMCDIILASPTAKFGQPEINLGVIPGGGGSQRLAQVIGKSR
TMEMVLTGRMVSAQEAANWGIVSRVVADGEGEVVKEAVAMAKDIASKSQIAVQAGKEVVN
AAYELNLAEGLRLERRLFHGLFATNDQKEGMSAFSEKRKPNFTHT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgctccgttttaaagccacgattgaacttttctccagtccgcctcatgtcc
acctcgcaacgacaatataatttcatccttgtttcgcgtccagagccttccgtcgttctt
gttaccctcaacaggcccaaagcattgaacgctttgagcagccctctattccaagagttg
aaccaagctctcgaggaagcagacaaagatgacacggttggcgcgatggttctaaccggc
tccgagaaagcctttgcagctggtgccgatatcaaagaaatgaaggataaacagtgcaag
ttttctaacgtgttcaagaacaagtttttggaaaattggggagaaattgcaagcctccgt
aagccagtgatagcggccgtcagtgggtttgcgctggggggtggctgcgaattagccttg
atgtgtgacattatcctggcctctccaaccgccaaatttggccagcctgaaatcaacctg
ggtgttatccctggtggaggcggttcccaaaggctcgcgcaggttattggaaaatctcgg
accatggaaatggttttgacagggcgtatggtctctgcgcaagaagccgcaaattgggga
atcgttagcagggttgttgcagacggtgaaggtgaggtcgtcaaggaggcggtggcaatg
gcgaaagatatcgcgagcaagagtcaaattgctgttcaggctggcaaagaagttgtgaac
gctgcttacgagctgaatcttgccgaaggcttgaggttagagagacggcttttccacggt
ttattcgcaaccaatgaccaaaaggagggcatgtctgcgttctcagagaagcgaaagcca
aacttcactcacacttag

DBGET integrated database retrieval system