KEGG   Laccaria bicolor: LACBIDRAFT_246558Help
Entry
LACBIDRAFT_246558 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
lbc  Laccaria bicolor
Pathway
lbc00600  Sphingolipid metabolism
lbc01100  Metabolic pathways
Module
lbc_M00094  Ceramide biosynthesis
lbc_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LACBIDRAFT_246558
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     LACBIDRAFT_246558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 6072285
NCBI-ProteinID: XP_001877105
JGI: 246558
UniProt: B0CY72
AA seq 317 aa AA seqDB search
MDTKNIVQWLSPYVAPFFALQYPTQTPAHPDSFPESGYYNAGKADICLVITCIAVMAVLR
DALRLGVFEPFARWKLSRDLDRKRHQPSVLRFAEQGWSVVYYTIQWSFGLYVHRNLPTEI
FDAKDLWLQYPHIPLAAPIKFYYLTQTAFYMHQMLILNAEARRKDHVQMMAHHIITVILM
VTSYFTNFTRVGCVIMVLMDWCDIFLPLAKMIRYIDISQLACDLTFACFLVSWLVTRHFL
FLFVIYSTVVDLPKHVPFLLNTEQGYYLTKSAYLAFCIMLGTLQVLQCIWFWMICRVAWR
VITTGNGASDDRSDEEE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaaaaatattgttcaatggctctcgccctacgttgcacctttcttcgcgctg
cagtatcccacacagacaccagcgcaccccgattctttccccgagtccggatactacaac
gccgggaaggctgatatctgtctcgtgattacctgtatcgctgtcatggccgtgttgcgc
gacgcgttgaggttgggtgtttttgagcccttcgcgcgctggaagctttccagagaccta
gaccgcaaacgacaccaaccaagtgttctccgcttcgctgagcaaggctggtcagttgtg
tattataccatccagtggtcatttggcctttatgtacaccgcaatctccctactgagatc
ttcgacgccaaagacctatggcttcagtatccccatataccactcgccgcacccatcaaa
ttttattatcttactcaaacagcattctacatgcaccagatgctaatcctgaatgctgag
gccagaagaaaggaccacgttcagatgatggcccaccacattatcaccgttatcctcatg
gtcacaagctacttcaccaattttacacgcgtgggctgcgttatcatggtgcttatggac
tggtgtgacattttcctaccgttagcgaaaatgatccgttatattgacatcagccaattg
gcgtgtgatctcacctttgcgtgtttcctcgtttcatggcttgttacgcggcatttctta
ttcctttttgtcatctattcgacggtagtcgacctcccaaagcatgttccattcctcctg
aatacggagcagggttattatttgacaaagtctgcataccttgccttctgcataatgctt
gggactctgcaggttctgcaatgtatttggttctggatgatatgtagagttgcgtggcgc
gtgatcacgacgggcaatggcgcgtcagatgatcgtagtgatgaggaagagtaa

DBGET integrated database retrieval system