KEGG   Laccaria bicolor: LACBIDRAFT_246874Help
Entry
LACBIDRAFT_246874 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
lbc  Laccaria bicolor
Pathway
lbc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    LACBIDRAFT_246874
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lbc03012]
    LACBIDRAFT_246874
Translation factors [BR:lbc03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    LACBIDRAFT_246874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 6072963
NCBI-ProteinID: XP_001877313
JGI: 246874
UniProt: B0D097
AA seq 826 aa AA seqDB search
MSRFFRQAGDSDSDSDSESESELMTSGDEEAPSKPTASAPKPAIDSESEESTDTDSEAGP
EGDGDETDDEGERPGVRIISAQEKRLKEMEATGKVMENALKINDWVAISTGEFLTLVLES
VAEQPIPPFYVRTLVNLESSINNALVKEKEAKKKMNATNAKALTAMKQKIKRAIKEYETD
VKKYLEDPEAFNREYAALVSREPIAPAAPGSRGATATTGDDTTVEEFTTVGKGGRGVQFT
SEGIFKNLHAVQEARGKKNTDRAEQIRILEKLLEVAVTPYQRIRVLLALISSRFDYNSSV
STHMPTELWLAAQREVDQLVSIIASDSNFSIQEVTEDYDELVERSASTERGVVHVRGSII
SFIDRLDDEFTRSLQNIDPHGTEYVDRLKDEKVLYCTICRAQAFYEKTNQNDPLGRVIMR
RLEHIYSKPNAVVQALEAAVDDSDVKPSMTLVAQGGTAALVHGLCVHLYKAGNSLLRTRA
MLSHIYHHALHNDFHTARDMLLMSHLQESIHSADVATQILYNRTVVQLGLCAFRSGLIKE
AQATLQDIFTTQRVKELLAQGVHQQRFQVLTPEQEKAEKQRQLPFHMHINTELLEAAFLV
SSMLIEIPLLASIDSEELKRKAISKPFRRLLDFADRQVFTGPPESTRDHIMQASKALQDG
EWETCRDLIQSIKIWSLMPEAAAVKEMLAKRIQEQGLRTYLFTYAPHYSTLSLSLLSRTF
SLSLRTVSSIVSKMIWNEELSASLDQSGGIVLFHRIDLSRPQQLAQVIAEKVAAMVDQNE
KALDVKMGGTGGWGERTDGSKGEKRGEQTQERRGRGERTRGARGMF
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtccagatttttcaggcaagcaggagattctgactctgactctgattcagagtcagag
tcagagctcatgaccagcggtgacgaagaagccccgtcaaagccgacagcttcagccccc
aagccagcaatcgactcagaatcagaagaatccacagatacggacagtgaagcaggacct
gagggagacggtgatgaaacagatgatgagggtgaacgtccaggtgtccgaatcattagt
gcgcaagagaagcgattgaaggaaatggaggctacaggcaaggttatggagaacgctctc
aaaattaatgattgggtggctatttctaccggcgagtttttaacattggttttggaatct
gtggctgaacagccgatcccgcctttttatgtccgaacgctagttaacttggaatcttct
atcaacaacgcccttgtcaaagaaaaagaagcgaagaaaaaaatgaacgctacaaacgcc
aaggccctaacagcgatgaagcaaaagataaaaagggcaatcaaggagtacgagacggat
gtcaaaaagtacctggaggatcctgaagccttcaaccgcgagtacgccgcactggtttcg
agggagccaattgcacctgctgcccctggttcccgtggagcaacggctaccacaggtgat
gataccactgtcgaggaattcaccacggttggaaagggtggacgaggtgttcagttcacc
tccgagggcatattcaaaaacctgcacgctgttcaagaagctcgaggaaagaagaatacg
gaccgcgccgaacagatccgcatcctagagaaactccttgaagtggcagttactccatac
cagagaatccgtgttcttcttgccctgatctcttcgcggttcgactacaactcttccgtc
tcaacacatatgccaacggagttatggttagccgcacagcgagaagtggatcagctcgtt
tcaataattgcatcggactccaacttttccattcaagaggtcacagaagactatgatgaa
cttgttgagcgctctgcttcaacagaacgaggagttgttcacgtccgaggctctatcata
agcttcattgaccgtctggacgatgaatttactcgtagtctacaaaatattgatccgcac
ggaaccgagtacgtggatcgcctcaaggacgaaaaggttctatattgcacaatatgtcgc
gctcaagccttttatgaaaaaacaaatcaaaatgacccccttggacgagttatcatgaga
agactggaacatatctattcaaagcccaacgccgtggtacaggcactggaagcagctgtg
gatgattctgatgtgaaaccttcaatgactcttgttgcacaaggaggcacggcggccctc
gtccacggcctttgcgttcatctctacaaagctgggaattctcttttgagaacacgagca
atgctcagccacatctaccaccacgctctacataacgactttcacactgcgcgtgatatg
cttttgatgtctcacttgcaggagtcaattcattcagctgacgtggctactcaaattctc
tacaatcgcactgttgtgcagcttggattatgcgccttccgatctggattgatcaaagag
gcccaggcgacactacaggatatattcactactcagcgagtaaaggaactccttgcacag
ggcgtccatcaacaacgcttccaagtgttaacacccgaacaagaaaaggcggaaaagcag
cggcagcttccctttcacatgcacataaacacagaattgctagaagccgcgtttcttgtc
tccagcatgctcatcgagatccccttacttgcaagcatcgactctgaagaattgaaacgc
aaggcaatttcaaaaccattccgaagattactggattttgctgatcgtcaagtttttacc
ggcccacctgagagcacgagagaccatatcatgcaagctagcaaggcattacaggacggt
gaatgggagacatgtcgtgacttaattcagagcatcaaaatttggagtctgatgcccgag
gctgccgcggtcaaggaaatgttagccaagcgcatccaagaacaaggcctgagaacctac
cttttcacatatgcaccccattacagcactctttctctttctcttctctccagaaccttt
tctctatcccttcggacagtctcgtcgatcgtttccaaaatgatttggaatgaagaattg
tcggcgtccctcgatcagtcaggtggcattgttctttttcatagaatcgacctttcacgc
cctcaacaattggcacaagttattgcggaaaaggtggcggctatggtggatcagaatgag
aaggcgttggacgttaaaatgggtggcacgggtggttggggcgagaggaccgatggcagc
aaaggggaaaaacgaggtgaacagacacaagaacgtagaggccgaggagagagaacaagg
ggtgctcgaggtatgttctga

DBGET integrated database retrieval system