KEGG   Laccaria bicolor: LACBIDRAFT_295646
Entry
LACBIDRAFT_295646 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lbc  Laccaria bicolor
Pathway
lbc00100  Steroid biosynthesis
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
Module
lbc_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LACBIDRAFT_295646
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LACBIDRAFT_295646
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 6083987
NCBI-ProteinID: XP_001888376
JGI: 295646
UniProt: B0DWS8
AA seq 426 aa
MSILNPRTTTYEFLGPPGAFLVTVGVPIATYALYFACSESSGGCPPALATIPVHVSDPNW
WKSLWDTDATLIYFAWYFFCVLAWAVLPGDRVSGTTLRTGETKQYKINAFSTYLLTLGIT
SGVIYRYGPESVTFIYNKWVGFVTASLLMSILQASACYFASFRSGKLLALGGNTGNHLYD
WFIGRELNPSIGSFDVKSFNELRPGLILWVIINISLACEQATRRGGLDKITDSMWLVLAF
QTWYVTDGLYNEPALFTTMDITSDGFGFMLAVGDLLWVPFTYTLQARYLAFHPVELGPVK
TAAILILNCIGYYIFRDSNGEKNDFRNGKNPKGLKYMTTAKGSKLLTSGWWGLSQHPNYM
GDLLMALAWCLPTGFDTPITYFYPVYFAVLLIHRQRRDDEACHKKHGDDWVKYKKLVPYR
IIPYVY
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtccatcctcaatccacggacaacaacctacgaatttctcggtcctccaggcgctttc
ctcgtcaccgtcggtgtccccatcgccacctacgcactctactttgcttgctcagagtca
tcaggcggatgtcctcctgcccttgcaaccatccccgtacacgtctcagatcccaactgg
tggaaatctctctgggatactgatgcaactctaatttactttgcttggtacttcttttgc
gttcttgcatgggcagtcttgcctggagatcgcgtatctggcaccactctcagaacaggc
gaaacgaaacagtacaagataaatgcattctccacttaccttcttaccctcggcatcacc
tccggtgttatctatcgctacggaccagaatctgtcaccttcatatacaacaaatgggtc
ggcttcgtcactgcgtctcttctcatgtccatactccaggcttctgcatgctactttgcc
tcattcagatcaggcaagctactggctttgggaggaaataccggaaatcatctttatgac
tggttcattggccgcgagcttaacccatctattggctcctttgacgtcaaatcattcaat
gagctcaggcccggtctcatcctttgggtcatcatcaacatcagcttagcttgcgagcaa
gccactcgtcgtggaggactcgacaagattacggactccatgtggctcgttctcgccttc
caaacatggtacgttaccgatggcttgtacaatgagcctgcgcttttcacaacaatggac
atcacaagcgatggctttggctttatgcttgctgtcggtgacctgctctgggttcctttc
acttacaccctccaagctcggtatcttgccttccacccagttgagcttggccccgtcaag
acggctgctatccttatcttgaactgtattggttattacatctttcgggattctaatgga
gagaaaaacgatttccgtaacgggaagaaccccaaaggtttgaaatatatgacaacagct
aaaggttcaaagttactcacttctgggtggtggggactttctcaacatcccaattatatg
ggcgacctcctgatggcgcttgcgtggtgcctgcctactggctttgacacgcccatcacc
tacttttaccctgtgtactttgctgtcctcctcattcacaggcagcgtcgcgatgatgaa
gcttgccataaaaaacatggagatgattgggtgaagtataagaagttggttccatatagg
atcatcccatatgtctattaa

DBGET integrated database retrieval system