KEGG   Laccaria bicolor: LACBIDRAFT_299218Help
Entry
LACBIDRAFT_299218 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lbc  Laccaria bicolor
Pathway
lbc00480  Glutathione metabolism
lbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LACBIDRAFT_299218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbc02000]
    LACBIDRAFT_299218
Enzymes [BR:lbc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LACBIDRAFT_299218
Transporters [BR:lbc02000]
 Other transporters
  Pores ion channels [TC:1]
   LACBIDRAFT_299218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6078046
NCBI-ProteinID: XP_001882270
JGI: 299218
UniProt: B0DEA6
AA seq 239 aa AA seqDB search
MTEQITLYTAKICPWAQRVELALQEAKVEYTRYEIDLENKPTWYASKVNPASKVPALAYG
GPKVSPDTPSEESVKLAESGVLLEFVADISGLLLPKDAVSRAKARFFIETATAKFSPAFY
GAVARGESPEGILTVIETIQALLPAEGYAVGEYTIADAAITPLFARANVALKNDIGAYDA
GEGVRVYNILQSDPKFARFRKYYDDVTARDTFKETFHEVSSFRRPMSSVVLTCLRRRSI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagattacgctttacactgccaagatttgcccatgggctcagagggttgaa
ctggcgctccaagaggcgaaagtcgagtacactcgctatgaaattgacctggagaacaag
cccacatggtacgccagcaaggtgaaccccgcaagcaaggtgccagctcttgcctacggc
ggtccaaaagtatcgccagacactccgtcagaggagtcagtaaaactggcggagtctgga
gttctcctggaatttgtcgcggacatctctggccttctactcccaaaagatgccgtctcg
cgtgccaaggctcgcttcttcatcgaaacggcgacggccaagttctcccccgcattttat
ggtgctgttgctcggggtgaatcaccagagggcatcttgaccgttatcgagaccattcaa
gcgttgctccctgcggaggggtatgctgtaggagaatacaccattgctgacgccgccatc
actcccctcttcgctcgtgcgaacgtcgcgctgaagaacgatatcggagcctatgatgcc
ggcgaaggcgtacgggtatataatatcttgcagtcagatccgaagtttgcaaggttccga
aagtactatgacgacgttacggctagggacaccttcaaggagacgttccatgaagtgagc
agtttccgtcgcccgatgtcctcggtcgtactgacgtgcctccgacgtaggagtatctga

DBGET integrated database retrieval system