KEGG   Laccaria bicolor: LACBIDRAFT_300566Help
Entry
LACBIDRAFT_300566 CDS       T01044                                 

Definition
(RefSeq) succinyl-CoA-ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lbc  Laccaria bicolor
Pathway
lbc00020  Citrate cycle (TCA cycle)
lbc00640  Propanoate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
Module
lbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LACBIDRAFT_300566
   00640 Propanoate metabolism
    LACBIDRAFT_300566
Enzymes [BR:lbc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LACBIDRAFT_300566
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LACBIDRAFT_300566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 6068972
NCBI-ProteinID: XP_001873761
JGI: 300566
UniProt: B0CPE2
AA seq 330 aa AA seqDB search
MFRQVGRSWSTNGRRAFSQSTSRKSYADTIQNLMIHKDTKVLCQGLTGKTATFHITEALA
YGTNMVGGVSPKKAGQTHLGLPVFGSVREAVRETKPDATILYVPPPTAADAIIEAIENEI
GLIVCVTEGIPQADEIRVMNALKSQSRSRLVGPNCPGVINPLGCKMGIQPGHIHTPGNIG
IVSRSGTLTYEAVAQTTDVGLGQSLCVGIGGDPFPGTQHVDVIKVFLEDPNTKGIVIIGE
IGGSMEEEAAEYLERHNKTRSHPKPVVGFIAGRTAPPGRRMGHAGAIISGGKGAASDKVK
ALEKAGVIVTDSPAKIGVEILKAMKAAGLV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgccaggttggacgctcctggtccaccaacggacgcagggcgttctctcagtcc
acgtcgcggaagagctacgccgataccatacagaaccttatgatacacaaagacaccaag
gttctatgccagggcttgacaggaaagaccgccacttttcatatcacggaagctctggcg
tacggtacgaacatggttggcggcgtgtcacccaagaaggctggccaaactcatctcggg
ctacccgtttttggtagcgttcgcgaggcggttagagagacgaaacctgatgcgactatt
ctgtatgttccaccccctactgctgccgacgcaattatagaggcaatcgagaatgagatt
gggctcattgtctgcgtgacagagggtattccccaagcagacgagattcgagtcatgaac
gctttgaaaagccagtctcgttctcggcttgttggtcctaattgccctggagttatcaac
cctcttggatgcaaaatgggcattcagccaggacacatacacacgcctggaaacattgga
attgtttctcgatcaggaacattaacctacgaagctgttgctcaaacgaccgacgtcggg
ctgggtcaatcgctatgcgtcggcatcggtggagacccgttccctggtacccaacacgtc
gacgtaatcaaggtcttccttgaggaccccaacacaaaaggtatcgttattattggagaa
atcggaggctcaatggaggaggaagcggcagagtacctcgagaggcataacaaaactagg
agccatcccaaaccagtggtcgggtttattgctggtcggactgcgcctcccggccgccgt
atgggacacgccggtgccattatttcgggaggaaagggtgctgcctctgataaggtgaaa
gcactagagaaagccggtgtgatcgtaacagatagcccagctaagattggtgtcgaaata
ttgaaggccatgaaagctgcgggcttggtataa

DBGET integrated database retrieval system