KEGG   Laccaria bicolor: LACBIDRAFT_307111Help
Entry
LACBIDRAFT_307111 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
lbc  Laccaria bicolor
Pathway
lbc04111  Cell cycle - yeast
lbc04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    LACBIDRAFT_307111
   04113 Meiosis - yeast
    LACBIDRAFT_307111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lbc01002]
    LACBIDRAFT_307111
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lbc03036]
    LACBIDRAFT_307111
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     LACBIDRAFT_307111
Peptidases and inhibitors [BR:lbc01002]
 Cysteine peptidases
  Family C50: separase family
   LACBIDRAFT_307111
Chromosome and associated proteins [BR:lbc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    LACBIDRAFT_307111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50
Motif
Other DBs
NCBI-GeneID: 6081441
NCBI-ProteinID: XP_001885819
JGI: 307111
UniProt: B0DPE8
AA seq 342 aa AA seqDB search
MTLDDLILKCFSTLSPKCKDEELEDLIYFILDLYSFHGVPVAIAEVDIAQLVVDLRAVLE
EHAAKLRQWKKTITGKSTTSLAKDQDEHLFLVLDKNVQGIPWESIPILRGRSVSRIPNIE
FLYDRLAFAKWKRQGELVEDELITGAVIDPRKGYFILNPSGDLARTEGRFRDWAHGMKKA
GWDGVIGQAVSEQQFVNALKTQDLVVYFGHGGGEQYIRSHRIRSLPKCAATMLWGRSSGA
LRELGDFDRTGTPYNYMLAGCPTLVANLWDITDKDIDKFSQSVFDKLRLTPADDSKWNEP
GKESHASPSLSLVASVAQSRDSCKLKYLTGAAPVVYGIPFYI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgacgatctgattctcaagtgtttctccacattgtcaccgaagtgcaaagat
gaagagctcgaggatctcatctacttcatcctggacctctactcgttccatggcgttcca
gtcgctattgcagaagtcgatatcgctcagctggtggtagaccttcgggctgtgttggaa
gaacacgcggcgaaacttcggcagtggaagaagacaattacaggaaagtcgaccacttca
ttggcgaaggatcaggacgaacacttgttcttggtccttgacaagaatgttcaagggata
ccctgggagagcataccgattctgagggggcgaagtgtcagtcgaatcccgaacatcgag
ttcttgtacgacaggcttgcattcgcaaagtggaaaagacagggcgagcttgtggaggac
gaattaatcactggagcggtcattgatcctcgaaaaggatacttcatcttgaatcccagt
ggcgatctagctcgaactgaaggtcgattccgggattgggctcatgggatgaagaaagct
gggtgggatggtgtgattggccaggctgttagtgagcagcagtttgtgaatgcgctgaag
acgcaggacttggttgtttactttggccatggaggtggagaacagtatatccgatctcat
aggattcgcagccttccgaaatgcgctgcaactatgctttggggtcgttcgtcgggtgct
ctccgggagttgggtgactttgataggacgggaacaccttacaattacatgctcgctggg
tgtcctacgctcgtcgcgaacttgtgggacatcacggacaaggacattgacaagttctct
caatccgtctttgacaagttgcgtttgactcctgcggatgatagcaaatggaacgaaccc
ggcaaggaatcccacgcttctccttctctatctctggtggcttctgtggcacagtcgcgg
gattcatgcaagctgaagtacctgaccggagcagctccggtggtgtacggtataccattt
tatatttga

DBGET integrated database retrieval system