KEGG   Laccaria bicolor: LACBIDRAFT_309201Help
Entry
LACBIDRAFT_309201 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
lbc  Laccaria bicolor
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lbc01001]
    LACBIDRAFT_309201
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lbc03036]
    LACBIDRAFT_309201
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     LACBIDRAFT_309201
Protein kinases [BR:lbc01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   LACBIDRAFT_309201
Chromosome and associated proteins [BR:lbc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    LACBIDRAFT_309201
   Centrosome duplication proteins
    Regulators of centriole replication
     LACBIDRAFT_309201
  Sister chromatid separation proteins
   Polo kinases
    LACBIDRAFT_309201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2
Motif
Other DBs
NCBI-GeneID: 6071911
NCBI-ProteinID: XP_001875883
JGI: 309201
UniProt: B0CVT0
AA seq 779 aa AA seqDB search
MTSATLHQALHHPNIVALYSVFSTSTARYHALELCPGGNLHDFLSSRDPPILPEADIRRL
LKGMANALLYLGREKIVHRNINPTNILLIGNTEPVSRMLVQSGFEWRASLVRNYPTSNLR
HLSTLLMMSYRKYAASRSTLHQIRSHSRYGFPVDVWSLGCVINVSFLGLQTLKSCSTGNR
DEDLSSWPQNAAIELKSLLAGLLEECQKTRLEPSQILSHPFLLTHPPIGRYSAMKESSCP
KTLSLQQVQIPALPRRRSLQHLLTEKRPGFAGLDLGNVALKALISRRVVSDPIPSSNALL
IRDHAQNDQAGFEFSSLTGDELKADRLQTSNHKQSTSFAERLQIFAHNPEQNALKEASEP
NCEVKYIPPLHATKPQPGLPIGTSRPLPFNTSLLNPKTHKSANGQITILPSRSLLIDFRE
NERRRGMKGDDVLLVDSTGTMIKIYKAPHLSVPCCLVEPTAEYTIHTLPSMYWKQYNDAG
RHVQQIKQRTPKLTLHTTNSKCSMMANGPLPDIELLFEPGVPAEFELSDKNLNASSLRIR
LSREHRSLEFAQHVIGDRGPEWTKQLIPCLEVHPFMSESIWMNLEDAKKKAIQQMSRFLR
LCETLETATDDWTSRTATVDNLADDGVEKLSDDLKGLDRTRSTSSISSFQILPRPPKLST
GPRRDTCSPQGKVSDEGDGQNLVGTRLPASLDIHRRLDLGLTSGGNAAFNDLVPQVGKIT
GPLETRFLSSVGWCTQYGSPGQSPQGEKYKVLFFDGSMLDIDLDKGWVELVDVRGKEIR
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagctacgttgcatcaagcactccaccatccaaatatcgtcgctctctattct
gtattctcaacatctaccgcgcgataccacgcccttgaactttgccctggcggaaaccta
catgattttctttcttcacgagacccaccgattctgccagaagcagatattcgtcgtctc
ctcaaaggcatggcgaatgccctcctttacctcgggagagaaaagatagttcatcgaaac
ataaacccaacaaacatcttattaattggaaataccgaacctgtgagtcgaatgcttgtc
caatccggatttgaatggagggcttcattggtcagaaactatccgacttcaaatttgcga
cacctatcgactctcctgatgatgtcctatcggaaatatgcggcctcgaggagtacgctg
caccagataagatcccattctcgttatggcttcccagtagatgtatggtcccttggatgc
gtcataaatgtgtcctttctagggctgcagacgttgaaaagctgttctacaggtaatagg
gatgaagacttgtcttcttggccccaaaatgctgcaatagagctaaaaagtttactggct
ggcctccttgaagaatgccaaaaaactcgacttgaaccgtcacaaattctatcgcacccg
ttcctgttgacccacccgccgatcggcagatattctgcaatgaaagaatcaagctgtcct
aaaacactgtctctccagcaagtgcagataccagcgctgccgcgacgacgttcccttcag
cacttgctgactgagaaaagacctggttttgctggtcttgaccttggcaacgtagctttg
aaggcactcatatctcggagagtcgtttcagatcctatcccaagcagcaacgctcttttg
attcgagatcacgcgcaaaatgatcaggcaggtttcgaattttcttcgttgactggggac
gagctgaaggctgatcgcttacaaacatctaaccacaagcaatcaacatctttcgccgag
agactacaaatatttgcacacaatccagaacagaatgccttgaaggaagcttcagagcca
aattgcgaggtaaaatatattcctcctcttcacgcgacaaaaccacagcctggtctccct
atcgggacgagtcgacctttgcctttcaacacttccttgctaaatcccaagacacataaa
tctgccaacgggcagataacaattctcccctcgcgttcattactgatcgactttcgtgaa
aatgagcgcaggcggggaatgaagggtgacgatgttctcttggtcgattcaaccggaact
atgatcaagatatacaaagcgccccatctgagtgtaccgtgctgtttggtggaaccgaca
gccgagtacaccattcatactctaccctcaatgtactggaagcagtacaacgatgcaggt
cgacacgtgcagcagattaaacaacgtactcccaagctgacgctgcacacaaccaactca
aaatgtagtatgatggcgaacggtccacttccagatattgaacttctattcgaacctggc
gtcccggcagaatttgagttatcagacaagaatcttaatgcgtcctccctgagaatacgc
ctttcccgggaacataggtctctggagtttgcgcagcacgttattggcgatagaggaccc
gaatggactaagcagctgattccttgcctggaggtgcatccgtttatgtctgaatcgatc
tggatgaacttggaagacgcgaaaaaaaaggcaatacagcagatgtcacgttttctcagg
ctgtgcgaaacattggaaactgctactgacgactggacttcgcggacggcaactgtcgat
aatcttgctgatgacggtgttgaaaaactgagcgatgatttgaagggactcgatagaacg
aggtcaacgtctagcatatcttccttccaaattctgccacgtcctccaaagttgtctact
gggccacgaagggatacttgttcgccacaaggcaaggtttcggacgagggcgacgggcag
aatttggtgggtacaaggctgcctgcctccttggatatccacagaagactcgaccttgga
ctaacttctggaggcaatgccgcgttcaatgacctcgtacctcaggtagggaagattaca
ggcccactggaaactcgattcctctcttccgtcggatggtgcacccaatatggatcgcca
ggacaatcaccacaaggcgagaaatacaaagttctgtttttcgatgggtcgatgcttgat
attgaccttgacaagggatgggttgagcttgtggacgtacgtggtaaggaaatccggtaa

DBGET integrated database retrieval system