KEGG   Laccaria bicolor: LACBIDRAFT_314107Help
Entry
LACBIDRAFT_314107 CDS       T01044                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lbc  Laccaria bicolor
Pathway
lbc00620  Pyruvate metabolism
lbc00630  Glyoxylate and dicarboxylate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01200  Carbon metabolism
Module
lbc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LACBIDRAFT_314107
   00630 Glyoxylate and dicarboxylate metabolism
    LACBIDRAFT_314107
Enzymes [BR:lbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LACBIDRAFT_314107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 6073333
NCBI-ProteinID: XP_001877912
JGI: 314107
UniProt: B0D1L6
AA seq 542 aa AA seqDB search
MVAGVQIHSKVAQKAQAELFTDGALKFLAALHRTFESTRQSLLVAREDAQRRYDAGVPLD
FAPETAHIRAEASWHCAPPAPGLEDRRVEITGPTDRKMVINALNSGAKTFMADFEDSSAP
TFANMVNGQINLRDAIRRQIDFEVGGKSYKLSQNPAVLIVRPRGWHLDEPRVTVDNAPVS
GSIFDFALYFYNNAHELVKRGSGPYFYLPKMEHYLEARLWNDIFVFSQSYIGMPHNTIRG
TVLIETLPAAFQMEEILFELRNHSSGLNCGRWDYIFSFIKKRRADRSAVLPDRKDITMTV
GFMDSYVRLLIQTCHKRKVAAMGGMSAQIPIKDDPKANEVAMAKVRSDKLREVTAGHDGT
WIAHPLINKIAREVFDKNMLGPNQYHVLRQEVKVAPSDLLSTKVPGQITLEGVRENVSTC
LAYTAAWVGGNGCIPLNYLMEDAATAEITRVQLWQWVRYGSRISDTGELITVEFVDKLVG
ELAPGIKGLVAGVKEENVKFAMEYLKGQIRRQWPSEFLTSDLMPYLAIADGVEPARQRVA
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccggtgttcaaatccactcaaaagtcgctcaaaaggctcaagcagagctattc
acagacggcgcactcaagttcctcgctgccctccaccgcaccttcgagtcgacgagacag
agcctgctcgtcgctcgcgaagatgctcagcgtcgctatgacgcgggggtgccgcttgac
tttgccccggagacggcgcatattcgcgctgaggcctcgtggcattgcgcaccgcctgct
cctggacttgaggaccgccgcgtagagattacgggtccgacagacaggaagatggtcatt
aacgctttgaacagcggtgcgaagacgttcatggctgattttgaagattcgagtgcaccg
acattcgcgaatatggtcaatggccagattaatttgcgagacgccattcgtcgtcagatt
gatttcgaggttggtggaaagtcgtacaagctctcccaaaatcccgctgtgcttatcgtt
cgtcctcgaggatggcacctcgacgaaccccgcgtaacggtcgataacgcccccgtctca
ggatccattttcgactttgccttgtacttctataacaatgcacatgaactcgtgaagcgc
gggtcggggccatacttttacctcccgaaaatggaacactatcttgaagcgcgtctctgg
aacgatatctttgtcttttcccagtcctatattggcatgccgcataacacgatccgtgga
accgttctcattgagaccctcccggctgcgttccagatggaggaaattcttttcgaattg
aggaaccattcctctggtttgaactgtggacgttgggattatatcttcagcttcatcaag
aagcgtagagctgaccggagtgccgtcttgccagataggaaggacattaccatgaccgtc
ggcttcatggactcctacgtcaggcttctcatccagacatgccacaagcgcaaagtcgcg
gctatggggggcatgtcggcccagatccctatcaaggacgaccccaaggccaacgaagtc
gccatggccaaggtccgctcggataagctccgcgaagtcactgctgggcacgacggcacc
tggatcgcgcacccactcatcaacaagattgctcgtgaggtatttgacaagaacatgctt
ggtcctaatcagtaccatgtccttcgccaagaagttaaagtcgccccgtccgacctgcta
agcaccaaagtgcccggccaaatcacgctcgaaggagtccgcgagaacgtatccacgtgc
ctcgcgtacaccgctgcctgggtgggcgggaacgggtgcatcccgctcaattacctcatg
gaagacgccgccaccgccgaaattacgcgcgtacaattatggcagtgggttcggtacggt
tcgcgcatctcggacacgggtgagctgatcactgtggagtttgttgacaagttggtgggt
gagcttgcgccggggataaagggccttgtggcgggtgtgaaggaggagaatgtgaagttt
gcgatggagtatttgaagggacagattaggaggcagtggcctagtgagtttttgacgagt
gatttgatgccgtatttggcgattgcggatggggttgagcctgctaggcagagggtggcg
gcgttgtag

DBGET integrated database retrieval system