KEGG   Laccaria bicolor: LACBIDRAFT_314121Help
Entry
LACBIDRAFT_314121 CDS       T01044                                 

Definition
(RefSeq) 60S ribosomal protein L39
  KO
K02924  large subunit ribosomal protein L39e
Organism
lbc  Laccaria bicolor
Pathway
lbc03010  Ribosome
Module
lbc_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LACBIDRAFT_314121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lbc03011]
    LACBIDRAFT_314121
Ribosome [BR:lbc03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    LACBIDRAFT_314121
  Archaea
    LACBIDRAFT_314121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L39 Nmad3
Motif
Other DBs
NCBI-GeneID: 6073033
NCBI-ProteinID: XP_001877916
JGI: 314121
UniProt: B0D1M6
AA seq 51 aa AA seqDB search
MPSQKTFRTKRILAKAGRQNRPIPQWFRLKSDTKIQYNAKRRHWRRTKLNI
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccaaaagactttccgcacaaaacgaattctcgcaaaggctgggaggcaaaac
aggcccatcccccagtggttccgtcttaagtcggacaccaaaatccaatacaacgccaag
cgccgtcactggcgcaggaccaagctgaacatctag

DBGET integrated database retrieval system