KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1024Help
Entry
LBF_1024          CDS       T00712                                 

Gene name
aceF
Definition
(GenBank) Bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00020  Citrate cycle (TCA cycle)
lbf00310  Lysine degradation
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01120  Microbial metabolism in diverse environments
lbf01130  Biosynthesis of antibiotics
lbf01200  Carbon metabolism
Module
lbf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBF_1024 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    LBF_1024 (aceF)
Enzymes [BR:lbf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LBF_1024 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABZ93551
Position
I:complement(1105181..1106413)
Genome map
AA seq 410 aa AA seqDB search
MAIEIKVPEMGESVTEATISAWTKKEGDAVKVDEVLAILETDKVSLEIPAPSSGVLKSIT
KKVGDVVHVRDIMGMIEEGAVAAAPVSSGGAAPKVETPSAQPNTGKVNDELPPAARKLIE
ENKLDATKITGTGRNGQITKEDVILFMEKGGAGSVAPSKTSAPSPEIPKAVVVSANSGPR
ETVVPMTKLRQTIANRLVNAQHTAAILTTFNEVDMSPIMELRNKYKDKFKETHGVGLGFM
SLFTKAAVAALKAFPAINAEIRGTDIVYKNYYDIGVAVGGPKGLVVPIVRNADLLSFAGV
EQEIARLAGKVKDGKISLEDMEGGTFSISNGGVYGSMMSTPILNPPQSGILGMHNIVKRA
VVVNDQIVIRPMMYLALSYDHRIVDGKEAVQFLVKIKEMVEDPTRLLFEV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaatcaaagtccccgagatgggggaatccgtaaccgaagcgaccatcagt
gcttggaccaaaaaagaaggcgatgccgtaaaagtagacgaagtgctcgctattttagaa
acagacaaagtttcattagaaatccctgccccgagttccggggttttaaaatccattacc
aaaaaggtgggggatgtggtgcatgtccgagacatcatgggcatgatcgaagaaggggcg
gtcgcggcagctcctgtgagttctggaggagcggctcctaaagttgaaactccaagcgca
caacctaacacgggcaaagtgaatgacgaactccctcctgcggcgcgtaaactcatcgaa
gaaaataaattagatgccacaaaaatcacaggcacgggtcgaaacggccaaatcacaaaa
gaagatgtgatcctttttatggaaaaaggtggggcaggttctgttgctccttccaaaact
tctgcaccaagtcctgagattccaaaagcagtagtggttagtgcaaactctggaccaaga
gaaacagttgtaccaatgacaaaactccgccaaacgatcgctaaccgattggtgaatgca
caacacacagcggccatcctcacgacattcaacgaagtagatatgtcaccgatcatggaa
cttcgcaataaatacaaagacaagttcaaagaaactcatggtgtgggtcttggtttcatg
tctcttttcacaaaagcagcggtggcagcccttaaggctttccctgcgatcaatgcggaa
attcgcggaacagacattgtctacaaaaactactacgacatcggagtggcagtgggtgga
ccgaaaggacttgtggttccgattgttcgtaacgccgacttactgagctttgctggtgtg
gaacaagagatcgcaaggcttgcgggcaaagtgaaagacggaaaaatttctttggaagac
atggaagggggaaccttctctatctcgaatggtggtgtgtatggatcgatgatgtcgaca
ccgatactcaaccctcctcaatcaggaatccttgggatgcacaacatcgtcaaacgcgcc
gtcgttgtgaacgatcaaattgtgatccgtccgatgatgtatctcgcactttcctatgac
caccgcattgtggatggaaaggaagctgtgcagttccttgtgaagatcaaagaaatggta
gaggacccaacgagactcctctttgaggtataa

DBGET integrated database retrieval system