KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1771
Entry
LBF_1771          CDS       T00712                                 

Gene name
panC
Definition
(GenBank) Pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00410  beta-Alanine metabolism
lbf00770  Pantothenate and CoA biosynthesis
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
Module
lbf_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:lbf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBF_1771 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LBF_1771 (panC)
Enzymes [BR:lbf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     LBF_1771 (panC)
SSDB
Motif
Pfam: Pantoate_ligase
Other DBs
NCBI-ProteinID: ABZ94278
UniProt: B0S9F1
Position
I:complement(1915146..1915997)
AA seq 283 aa
MIVVSEIADLKTIISEWKQNQETIGFCPTMGTLHDGHMDLVKTSKGQCTKTIVSIFINPT
QFNDPKDFDAYPKNTESDLKLCEEHGVDLVFLPSVEVIYPKSQTPIQMSIPSLQTTLCGR
TRPGHFEGVLQIVSKLFHLTEPNYGFFGLKDYQQYRIISAMVEELNFPIKILGVPTKRES
DGLAMSSRNLRLSPKDRETASLIPRMFQLAKKTLLGGEKNLIVWKEILTDFLLTGSNVKI
DYLEIVDPITLQPLSNLNGELLLATAVFVGEVRLIDNEVLVSP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgatcgttgtatcagagattgcagatctaaaaacgatcatttccgaatggaaacaaaat
caggaaaccattgggttttgtccgacaatgggtacccttcatgacgggcatatggatttg
gttaaaacttcgaaaggacaatgtactaaaacaattgtctccatctttatcaatccaaca
caattcaatgatccaaaagactttgatgcgtatcccaaaaatacagaatcggatttaaag
ttatgcgaagaacatggagtggatttggtttttttaccaagtgtggaagtgatctatcca
aaatcacaaactcccatccaaatgagtattcccagcttacagacaactctctgtggacga
acaaggccaggtcactttgaaggtgtattacaaattgtttcaaaacttttccatctaaca
gaacctaattatggattttttggactcaaagactaccaacagtatcgaatcatttccgcc
atggtagaagaactgaattttcctatcaaaattctcggagttcccacaaaaagggaatcg
gatggactggcgatgagttcgagaaatcttaggctttcaccaaaagatagagaaacggca
tctcttattccaagaatgttccaacttgccaaaaaaacattattaggtggggaaaagaac
ctgattgtttggaaagaaattctaactgacttccttttgactggatccaatgtgaaaatt
gattatttagaaattgtcgatcctatcactttacaacctctctcaaatttaaatggagaa
cttttactggctactgccgtatttgttggtgaggttcgtctcattgacaatgaagtttta
gtctctccctaa

DBGET integrated database retrieval system