KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_2531Help
Entry
LBF_2531          CDS       T00712                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00900  Terpenoid backbone biosynthesis
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBF_2531 (dxr)
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LBF_2531 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ABZ95015
UniProt: B0SDN1
Position
I:complement(2710763..2711923)
Genome map
AA seq 386 aa AA seqDB search
MVGVSVLGISGSVGTSTVKVLRQFPDQFDLRSFSVHSNWNVAKALVEEFSPEVICITDPK
LVGKFGDSYLSTKILYGDKALIDLVQLPSVGVVVTAVMGARGVLPTIAAIEAGKKIAIAN
KETLVTFGPLINRLVAKHNTVMVPVDSEHNALFQLIERETRSNIRAITLTASGGSFRTLP
LEALEHVSVKQALNHPTWSMGPKITVDSAGLINKGLEVIEAHFLFGFSYDEIEVVIHPQS
ITHGIIETTDGACLLYASHPDMVYPIAHSLFYPNPTPQMLIERKPSTWNTFEFFPPDTKR
YPGLLLAYQAGKAGGAAPGIFNAANEEAVALFLEEKISFTTIPRLIESALNQIENVFPET
LDGYLEKDQETRNYIQREFNQGGVTT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtaggtgtttcggtattaggaatctctggttctgttggtacttccacagtgaaggta
ctccgacaattccctgaccaatttgatttacgtagtttttccgttcattccaattggaat
gtagcaaaggccttggtagaagaattttctccagaagtcatttgtatcacagatcccaag
ttagtggggaagtttggcgattcgtatctctcaacaaaaattttgtatggagataaagca
ctcattgatttggtacaattgccatctgttggtgtggtggtgacggcagtgatgggagca
cgcggagtgttaccaacgattgctgccattgaagccgggaaaaaaattgccatcgccaat
aaggaaacgcttgttacctttggacctcttatcaatcgattggtggcaaaacacaatacc
gtcatggtccctgtggattctgaacacaatgcactcttccaactcatcgaaagagaaaca
aggtccaatatccgagctatcactctcacggcttcgggaggaagttttcgaacccttccc
ttggaagcattggaacatgtatccgtaaaacaggcgctcaatcatcctacttggtccatg
ggtcccaaaatcacagtggattcagcaggtcttatcaacaaaggattagaagtgatcgaa
gcgcattttctttttggattttcgtatgacgagatcgaggtggtgattcatcctcagtca
atcacccacgggatcatcgaaacgacagacggtgcttgtttgttatatgcaagccatccc
gatatggtctatcccattgctcactctttattttatcccaatccaacacctcaaatgctc
atcgaacgaaaaccttcgacttggaacacgtttgaatttttcccaccagatacgaagcga
tatccgggattgttactggcctaccaagcagggaaagcaggtggtgcggctccaggtatc
tttaatgccgcaaacgaagaggcagtcgctttatttttagaagaaaaaatttctttcacc
acaattccaaggctcatcgagtcggctctgaaccaaattgagaacgtatttccagaaacg
ttagatgggtatttggaaaaagaccaagaaacacgaaattatatccaaagagaatttaat
caagggggagtgactacatga

DBGET integrated database retrieval system