KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_2585Help
Entry
LBF_2585          CDS       T00712                                 

Definition
(GenBank) Xanthosine triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LBF_2585
Enzymes [BR:lbf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     LBF_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABZ95069
UniProt: B0SE38
Position
I:complement(2773155..2773751)
Genome map
AA seq 198 aa AA seqDB search
MTKKTLAFASGSDHKTKEMQMLLSPFGYEIVTPKILGIPFSPEETESTFVGNSFIKSKEL
FRLTGFPSFADDSGISVDALGGEPGVLSARFGGPGLSDKDRALYLLNKLGTNHNRKAHYS
CVVSFVDANHQVSFEGKVEGLIASDYDELGKFGFGYDPIFYYPEFGKRFSEVPEGEKNKV
SHRKKAMELFLEWFQTIQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ctgacaaaaaaaacattagcatttgcatctggcagtgaccataaaacgaaagaaatgcaa
atgttactctcacccttcgggtatgaaattgtcacacccaaaattctcggaattccattt
tctccagaagaaacagaatccacatttgttggaaattcttttatcaaatccaaagaactc
tttcgcctaacaggttttccttcgtttgcagatgattcggggatctctgtggatgcattg
ggtggtgaacctggagtcctatcggcaaggtttggtgggccagggttatcagataaagat
agggcattgtatttgctaaataaactaggaaccaatcataatcgaaaggctcattactct
tgtgtggtcagttttgtggatgcgaaccatcaagtttcatttgaaggaaaagtagaaggc
ctcattgcatctgattacgatgaattgggaaaatttggttttggatatgatcctattttt
tattacccagagtttgggaaacgtttttcagaagtacctgaaggagagaaaaacaaagtc
tctcatagaaaaaaagcgatggaactatttttggaatggtttcaaactatccaataa

DBGET integrated database retrieval system