KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_4172Help
Entry
LBF_4172          CDS       T00712                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00010  Glycolysis / Gluconeogenesis
lbf00030  Pentose phosphate pathway
lbf00051  Fructose and mannose metabolism
lbf00052  Galactose metabolism
lbf00680  Methane metabolism
lbf01100  Metabolic pathways
lbf01110  Biosynthesis of secondary metabolites
lbf01120  Microbial metabolism in diverse environments
lbf01130  Biosynthesis of antibiotics
lbf01200  Carbon metabolism
lbf01230  Biosynthesis of amino acids
lbf03018  RNA degradation
Module
lbf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBF_4172 (pfkA)
   00030 Pentose phosphate pathway
    LBF_4172 (pfkA)
   00051 Fructose and mannose metabolism
    LBF_4172 (pfkA)
   00052 Galactose metabolism
    LBF_4172 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LBF_4172 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LBF_4172 (pfkA)
Enzymes [BR:lbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBF_4172 (pfkA)
Protein phosphatases and associated proteins [BR:lbf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBF_4172 (pfkA)
Messenger RNA biogenesis [BR:lbf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LBF_4172 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABZ95994
Position
II:complement(176188..177495)
Genome map
AA seq 435 aa AA seqDB search
MNENDTKVEQFGPCTFPNPAGYDYWTEDNSVVLFQTIFSGPDDAKKTIETSPVFFEQAGP
KEKIYFRPEEVTAGIVTCGGLCPGINDVIRALVMELHYRYKVPRILGFPFGYEGLVKKFG
HRPIELTPDKVAHIMNFGGSILGSSRGNQKIEEMVDTLFLYGVKMLFCIGGDGTLRGAQA
IQEEVKKRKEDIAIVGIPKTIDNDINYVQKTFGFSTAFSKAVEAVNCAHEEAKGAPNGIG
LVKLMGRHSGFIAVNSALASKNVNFVLIPELDFDLEGEGAFLPVLKDRVQRRGHAVVIIA
EGAGQKYFEDKGEKDRSGNKKLADVGVYIKDKITEYFQKEGVALNLKYIDPSYIIRSVPA
NAEDSVFCGFLAQNAVHAAFAGRTGCVVGIWNNVFTVMPISLAIAERKVLRPERSTLWRA
LLASTGQPNSMKAKV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgatacaaaagtagaacaatttggaccttgtaccttcccaaacccagcg
gggtatgactactggacagaagacaattcggttgtgctcttccaaaccatcttttctgga
ccagacgatgcaaaaaaaaccatcgaaacaagtcccgttttctttgaacaagccggtccg
aaggaaaaaatctactttcgacccgaagaagtgacagcagggatcgttacctgtggggga
ctttgccctgggatcaatgatgtgatccgagcacttgtgatggaattgcactatcgttat
aaagtaccgaggatcctcggattcccttttgggtatgaagggttagtgaaaaaatttgga
cataggcccattgaactcactcctgataaggtggctcatatcatgaattttggtgggtcc
atccttgggtcttccaggggcaatcagaagattgaagagatggtcgatactttgttttta
tatggtgtgaagatgttgttttgtatcggaggggacgggaccttacgcggagcccaagcc
atccaagaagaagtgaaaaaacgaaaggaagacatcgccatcgtaggcattcccaaaacc
atcgacaacgatatcaattatgtccaaaaaacatttggattttcgacagcctttagtaag
gcggtggaagctgtgaactgcgcccatgaagaagcaaaaggagcaccgaatgggattggt
cttgtgaaactgatggggcgccactccggattcattgctgtgaattctgctttggcttct
aagaatgtaaactttgtcctcatccctgaacttgattttgatttagaaggagagggtgct
tttctgcctgttttaaaagacagagtgcagagacgaggccatgcggttgtcatcatcgcc
gaaggggcagggcaaaagtacttcgaagacaagggagaaaaagatagatcgggtaacaag
aagttggcggacgttggtgtatacatcaaagataaaatcaccgaatactttcaaaaagaa
ggtgtggcactgaatctaaaatacattgacccgagttacatcattcgttccgtgcctgcc
aatgcggaagattccgtgttttgtggattcctagctcaaaatgccgtgcacgctgcgttt
gcaggtcgtacaggatgtgtggtcgggatttggaacaatgtgtttacggtgatgcccatt
tctttggcgattgcagaacgaaaggtacttaggccagagcggagtacgttatggcgagca
ctccttgcttccacgggccaaccgaattcgatgaaggcgaaagtttaa

DBGET integrated database retrieval system