KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1196Help
Entry
Lbuc_1196         CDS       T01477                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00010  Glycolysis / Gluconeogenesis
lbh00071  Fatty acid degradation
lbh00350  Tyrosine metabolism
lbh00625  Chloroalkane and chloroalkene degradation
lbh00626  Naphthalene degradation
lbh01100  Metabolic pathways
lbh01110  Biosynthesis of secondary metabolites
lbh01120  Microbial metabolism in diverse environments
lbh01130  Biosynthesis of antibiotics
lbh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lbuc_1196
  Lipid metabolism
   00071 Fatty acid degradation
    Lbuc_1196
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lbuc_1196
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lbuc_1196
   00626 Naphthalene degradation
    Lbuc_1196
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lbuc_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 MTS TrkA_N Methyltransf_25 Methyltransf_11 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEB73451
UniProt: F4FVV2
Position
1260496..1261512
Genome map
AA seq 338 aa AA seqDB search
MKAAVVRDPVDGYVDIKDVTLRPIHQGEALVQVEYCGLCHTDLHVAEGDFGKVPGRIIGH
EGVGKVIQVADDVTNLKIGDRVSIAWFYRGCGHCEYCITGRETLCRNVQNSGYTVDGAMA
EQVIVPADYAVKVPEGLDPIEATSLTCAGVTMYKALKVGDTRPGQWVEVVGCGGLGNLAV
QYAHNVFGAHVVAVDGNEQKLQAAKDNGADITINRHDPDVADQIQKKVGGVHNAQITAVT
TEAFTTSVNALRPDGKLVAVALPKGDMALNIDKTVLDGIQVAGSLVGTRQDLAETFQFGA
EGKVKPIVQTRRLDEVNDIIDEMKANKIVGRMVVDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtaagagacccagttgatggatatgttgatattaaagatgttact
ttacgccccattcaccaaggtgaagccttagttcaagttgaatattgtggattatgtcac
acagatttacacgttgctgaaggtgactttggtaaggttcctggccgaatcatcggtcac
gaaggtgtcggaaaagtcattcaagttgccgacgatgtcactaacttaaagattggcgac
cgtgtttcaatcgcttggttctacagaggctgtggtcactgtgagtactgtatcactggc
cgtgagacactctgccgtaacgttcaaaattccggctacacagttgatggtgctatggct
gaacaagtcattgtccctgcagactacgccgttaaagtaccagaaggacttgatccaatc
gaagcgacttcattaacctgtgccggcgttacgatgtataaggcactcaaagttggcgac
actcgtcccggccaatgggttgaagtcgttggttgtggtggcttgggtaacctcgctgtt
caatatgcccataacgtctttggtgcccatgtggtagccgttgatggtaacgagcaaaaa
cttcaagcagctaaggacaacggtgcagatatcaccatcaaccgtcatgatccagatgtt
gccgatcaaattcaaaagaaggttggcggcgtgcacaatgctcaaattactgccgttaca
actgaggccttcactacatctgttaacgctttgcgtccagatggcaagttggttgctgtt
gcccttcctaagggtgatatggcacttaacatcgataagacggttctcgatggcattcaa
gttgccggttcactggttggtaccagacaggacctcgctgaaacattccagttcggcgct
gaaggcaaagtaaagccaatcgtacaaactcgtcgacttgatgaggtcaatgacattatc
gatgaaatgaaagccaataagattgttggccgaatggttgttgattttactaaataa

DBGET integrated database retrieval system