KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1604Help
Entry
Lbuc_1604         CDS       T01477                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00450  Selenocompound metabolism
lbh00970  Aminoacyl-tRNA biosynthesis
lbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Lbuc_1604
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Lbuc_1604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lbh01007]
    Lbuc_1604
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lbh03016]
    Lbuc_1604
Enzymes [BR:lbh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Lbuc_1604
Amino acid related enzymes [BR:lbh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Lbuc_1604
Transfer RNA biogenesis [BR:lbh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Lbuc_1604
 Prokaryotic type
   Other AARSs
    Lbuc_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AEB73852
Position
complement(1647068..1649095)
Genome map
AA seq 675 aa AA seqDB search
MAESKPTFYITTPIYYPSGKLHIGNSYTTIACDAEARFKRAMGYDVFFLTGTDEHGLKIE
QKAEQLGMSPKDYVDQMAASIKQLWKKLEISNTKFIRTTDDYHEKAVADIFQKLLDNGDI
YLGEYTGWYSVSDEEYFTESQLAEVYRDKNGKVTGGKAPSGHEVQLVHEQSYFFKMSKYA
DWLLRYYKDNPNFIQPATRMNEMIKNFIEPGLEDLAVSRTTFTWGVPVKSDPKHVVYVWI
DALTNYITALGYDGKDDSNFKKYWPANVQMVGKEIVRFHTIYWPIILHALGLPLPKTVYG
HGWLLMKDGKMSKSKGNVIYPETLVDRYGLDALRYYLLRAMPYANDGLFTPEDFIDRLNF
DLANDLGNLLNRTVSMINKYDGGILPAYKAGVNEADKELEETAATVIANYKQLMNDLHFS
DALAETWKLVSQTNKYIDQTEPWNLAKNPDDKDKLDAVMAHLAAGLRVIAELISPVMTHA
PKEIFAQLGITEDIDLEDLKFEDVPAGVKAVAKGTPIFPRVEVDDEVDYIKQQMTKTDKA
KGRAAMKEAAEADFNPEETNLNLTKKEVRFEAFEKIELKVAEIKDVNKVEGADKLLQFRL
DAGDDGDRQILSGIAEWYPDYKQLIGKKVIIVSNLKPRKMRGQVSQGMLLSVEHKDGNVE
LVTVGSHLENGVTLE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagtaagccaacattttatatcacaacaccaatttattatccatccgggaag
ttacatatcggcaattcctacacaacaattgcctgtgatgccgaagcacgtttcaagcgg
gcaatgggctatgacgtcttcttcctgacagggacggatgaacacggattaaagattgaa
caaaaagcagaacagttggggatgtcgcctaaggactatgttgatcagatggctgcatca
atcaaacaactttggaaaaagctggaaatttccaacaccaaattcattcgaacaaccgat
gattaccatgaaaaagcggtcgccgatatcttccagaaactactggacaatggcgacatt
tatttgggtgaatataccggctggtattcggtatcggacgaagagtactttactgagagt
caactcgccgaggtttaccgcgataaaaacggcaaggtaaccggtggtaaagcacccagc
ggccacgaagttcaattggttcacgagcagtcatacttcttcaaaatgagtaagtatgct
gattggctgctgcgatattacaaagacaatcctaacttcatccagccggcaacccggatg
aatgaaatgatcaaaaacttcatcgaacccggtttggaagacttagcggtttcgcggacg
acctttacttggggtgtcccggtcaagtcggatccaaagcacgtggtttacgtttggatc
gatgctttgaccaactatattactgctcttggctatgacggcaaagatgacagcaacttt
aagaaatattggccagccaatgtgcaaatggtcggtaaggaaattgtccggttccatacg
atttattggcccatcattttacacgccttgggactgccgcttcctaaaacggtttatggg
catggctggctgctgatgaaggacggtaaaatgtccaagtctaagggaaatgtcatttac
ccggaaactttagttgaccgttatggtttggatgcattgcggtattacttgctccgcgca
atgccttacgccaatgatggtctgtttacgccagaggacttcattgaccggttgaacttt
gatttggcgaatgatctcggcaacttgttgaaccgaacagtttctatgatcaacaagtat
gacggcggcatcttacctgcatacaaggccggcgttaacgaagctgacaaagaattggaa
gagactgccgccaccgtgattgccaattacaagcaattaatgaatgatttgcacttctcc
gatgccttggcggaaacttggaaactcgtttcccaaaccaacaagtacatcgaccagacc
gaaccatggaatctggctaaaaatcctgatgacaaagataagcttgacgctgtcatggct
catctcgcagccggtcttcgggtcatcgctgaattaatcagtccggttatgactcacgcc
cctaaagaaatctttgctcaattagggattacagaagacattgacctcgaagatttgaag
tttgaagacgttcctgccggtgtgaaagccgttgccaaggggaccccaatcttcccaaga
gtcgaagttgacgatgaggtggattacatcaaacagcaaatgaccaagacagataaggct
aaggggcgtgcagccatgaaagaagctgccgaagctgattttaatcctgaagaaaccaat
ttgaatttaaccaaaaaagaagttcgttttgaagcctttgaaaagattgaactcaaagta
gccgaaatcaaagacgttaacaaggttgaaggcgccgacaagctgcttcaattccgcttg
gatgccggtgatgacggcgatcgacaaattttgtcgggaattgctgaatggtatccggat
tataagcagttaattggtaaaaaagtgattatcgtgtcgaacctgaaaccaagaaagatg
cgcggtcaagtcagccaaggaatgttactgtccgtggaacataaagatggcaacgttgag
ttggtaaccgtcggatctcacttggaaaatggtgtcacactggaataa

DBGET integrated database retrieval system