KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2009Help
Entry
Lbuc_2009         CDS       T01477                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Lbuc_2009
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Lbuc_2009
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Lbuc_2009
    1.1.1.-  
     Lbuc_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C ADH_N_assoc ADH_N_2 ApbA ELFV_dehydrog DUF2045
Motif
Other DBs
NCBI-ProteinID: AEB74255
UniProt: F4FU96
Position
2099363..2100433
Genome map
AA seq 356 aa AA seqDB search
MKAVRIYGEKDIRVEDVEIPEPKDDQVQIKVKYCGICGSDLHAYLEGWGLPTVPYPLTGK
NVPITLGHEFSGEIVKVGKDVDDLQVGDHVAVEPLLACGKCENCRAGNYNFCNRAVSTDG
AGNFLGFSEDGGMAEFANVQGVFAHKMPKDMDFELGALAEPTAVVYEAIKKSHLREGQNV
AVMGAGPIGLLEAVLAKIAGANHVYIVDVSKVRLDKAKELGIEHVLDPSQDDVEKIIKQD
LPNGVDITFECAGVQATFDSALKVTKRTGIIQVVALYAKPVTMNMTDDLIMQGKDVITTL
CYNNSFPNVLGIIDNHKDLFKKVVTKKVSLDNALEDGIKALSTDKSQVKIMIDPSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtacgtatttatggtgaaaaggatatcagagttgaagacgttgagattcca
gaaccaaaggatgatcaagttcaaattaaagttaaatattgtggaatttgcggaagtgat
ttgcacgcctatctcgaaggctggggcctgccaaccgttccttatccgttaaccggtaaa
aacgtgccaattacgctggggcacgaattctcaggtgaaattgttaaagtcgggaaagac
gttgacgacttacaagtcggtgaccacgttgccgttgaaccacttttagcttgcggcaaa
tgtgaaaactgtcgggcaggaaactataacttctgtaaccgtgccgtttcaactgatggc
gccggcaacttcctgggcttctcagaagatggtgggatggctgaatttgccaacgttcaa
ggggtctttgcccacaagatgccaaaagacatggactttgaattaggtgctttggcagaa
ccaaccgccgttgtttacgaagctatcaagaagagtcatttgcgtgaaggccaaaacgtt
gctgtcatgggagccggcccaattggcttgctggaagctgttttagctaagatcgcaggt
gccaaccacgtatacatcgttgatgtttctaaagttcgtttggacaaagccaaggaatta
ggcattgaacatgtccttgacccaagccaagacgacgttgaaaagatcatcaaacaagac
ttaccaaatggtgtggacattaccttcgaatgtgccggcgttcaagcaacctttgattca
gcattgaaagttacgaagcgaaccggaattattcaagtagttgccctctatgcaaaacca
gttaccatgaatatgactgacgacctgattatgcaaggtaaagacgttatcaccaccctc
tgctacaacaactcattcccgaatgtgttaggcattattgataaccacaaggatctgttc
aagaaagttgtcactaagaaagttagcttggataatgcattggaagacggcattaaagct
ctctcaaccgataaatcacaagttaagattatgatcgatccatcactgtaa

DBGET integrated database retrieval system