KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2156Help
Entry
Lbuc_2156         CDS       T01477                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00030  Pentose phosphate pathway
lbh00480  Glutathione metabolism
lbh01100  Metabolic pathways
lbh01110  Biosynthesis of secondary metabolites
lbh01120  Microbial metabolism in diverse environments
lbh01130  Biosynthesis of antibiotics
lbh01200  Carbon metabolism
Module
lbh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lbuc_2156
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lbuc_2156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbh04147]
    Lbuc_2156
Enzymes [BR:lbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Lbuc_2156
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Lbuc_2156
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Lbuc_2156
  Exosomal proteins of colorectal cancer cells
   Lbuc_2156
  Exosomal proteins of bladder cancer cells
   Lbuc_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Cas9_b_hairpin
Motif
Other DBs
NCBI-ProteinID: AEB74399
Position
2272116..2273594
Genome map
AA seq 492 aa AA seqDB search
MPTERRSLIMLFGATGDLATRKLYPAMLKLFEKGNIRDHFAVIGTSRYKFDDEKYREMVI
KSVSKESTNKKQIADFASHFYFVTHDVTDLEHYSVLKNKANELDKKYELNGNRVFYISMA
PNFFGTVAKNLKAQHLLSEGNGFNRLVIEKPFGRDFESAKQLNDDLSNAFEEDQIFRIDH
YLGKEMIQNIEAIRFGNTIFEALWNNRYIDNIQVTLAEKLGVEERAGYYDNSGALRDMVQ
NHIMQIVSLLAMEQPVAFKDTDIRAEKVKALRSLRVYNVAEASSNFVRGQYAAVGNDKEY
REEDGVPKDSNTETFVAGKLLFDNYRWSGTPFYIRTGKKLADKFTRVDVVFKKPLVDIFA
FPQSGSAPLSANVLTIFIEPNQGFSLMVNAKNSEQGFHTEPVQLQYLEDSKRTRETPQPY
ERLIHDVLKGDGTNFASWPEVASAWKFVDQIRRVWDIQQPMFPNYIPGSMGPVSADELLA
RDHREWVYKLNK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgccaactgaaagacgttctttgattatgctcttcggagcaactggtgaccttgccact
cgtaaactttatcccgcaatgttaaagcttttcgagaagggaaacattcgcgatcacttt
gctgtgattggaacttcccgttacaagttcgatgatgaaaaataccgtgaaatggtcatc
aagtctgtttctaaagaatctactaataaaaaacaaattgctgatttcgccagccatttc
tattttgtgacccatgatgtgactgaccttgaacactattctgtattgaaaaacaaagcc
aacgagttggacaagaagtatgaattgaacgggaaccgcgtgttctacatttcaatggca
cccaacttcttcggaaccgttgctaaaaaccttaaggctcaacaccttctctccgaagga
aacggctttaaccgcttggtcattgaaaagccatttggccgtgatttcgaatcagccaaa
cagttaaacgacgacctaagcaatgcctttgaagaagaccaaatcttccgaattgaccat
tacttaggtaaggaaatgatccaaaacatcgaagctattcgtttcggtaacaccattttc
gaagccctctggaacaaccgttacatcgacaacattcaagtcacccttgctgagaagctg
ggtgttgaagagcgtgccggttactacgacaactccggtgcccttcgtgacatggttcaa
aaccacatcatgcagattgtcagtttgcttgcgatggaacaaccggttgcgttcaaggat
actgatatccgtgctgaaaaagtcaaagcattgcgtagcctgcgggtttacaacgttgca
gaagcatcaagcaactttgtccgtggtcaatacgctgccgttggtaacgataaagaatac
cgtgaagaagacggtgttccaaaggattccaacactgaaacctttgttgccggcaagttg
ttattcgataactaccgttggtcaggcacaccgttctacattagaaccggtaagaaactc
gctgacaagttcacccgagttgatgttgtcttcaagaagccattagttgacatcttcgcc
ttcccacaaagcggcagtgcaccactgagtgccaacgttttgactatcttcatcgaacca
aaccaaggcttctcattgatggttaacgccaagaactccgaacaaggattccacactgaa
cccgttcagttgcaataccttgaagattcaaagcgcacccgcgaaacaccacaaccttac
gaacgcttaatccacgacgttttgaagggcgacggtaccaacttcgccagctggccagaa
gttgccagtgcttggaagtttgttgatcaaatccgtcgagtttgggatattcaacaacca
atgttccctaactacattccaggatcaatgggcccagtttcagctgatgaattgcttgcc
cgcgatcaccgtgaatgggtatacaaattgaataagtaa

DBGET integrated database retrieval system