KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_2177Help
Entry
Lbuc_2177         CDS       T01477                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00071  Fatty acid degradation
lbh00072  Synthesis and degradation of ketone bodies
lbh00280  Valine, leucine and isoleucine degradation
lbh00310  Lysine degradation
lbh00362  Benzoate degradation
lbh00380  Tryptophan metabolism
lbh00620  Pyruvate metabolism
lbh00630  Glyoxylate and dicarboxylate metabolism
lbh00640  Propanoate metabolism
lbh00650  Butanoate metabolism
lbh00900  Terpenoid backbone biosynthesis
lbh01100  Metabolic pathways
lbh01110  Biosynthesis of secondary metabolites
lbh01120  Microbial metabolism in diverse environments
lbh01130  Biosynthesis of antibiotics
lbh01200  Carbon metabolism
lbh01212  Fatty acid metabolism
lbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lbuc_2177
   00630 Glyoxylate and dicarboxylate metabolism
    Lbuc_2177
   00640 Propanoate metabolism
    Lbuc_2177
   00650 Butanoate metabolism
    Lbuc_2177
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lbuc_2177
   00072 Synthesis and degradation of ketone bodies
    Lbuc_2177
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lbuc_2177
   00310 Lysine degradation
    Lbuc_2177
   00380 Tryptophan metabolism
    Lbuc_2177
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lbuc_2177
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lbuc_2177
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Lbuc_2177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbh04147]
    Lbuc_2177
Enzymes [BR:lbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Lbuc_2177
Exosome [BR:lbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lbuc_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB74420
UniProt: F4FVC6
Position
2302546..2303730
Genome map
AA seq 394 aa AA seqDB search
MKKIVIIDAKRSAIGKLNGSLSSLTAEQLGSKVTRALLKDASLSGSQVDQVIFGNAIQAG
NGQNIARQIELNSQIPESKTAFTVNQVCGSGLQAIHQAQSALLLGEVETVIAGGTESMSN
VPYLNMSQRKATKFGPVTLYDGLQRDGLSDSATDEPMGMTAENVADQYHVSREEQDAFAL
RSHQLAARATEQHYFDDEIIPIELNQPKSHAPHIVAQDESIRVDTNLEKLAALRPAFKPN
GSVTAGNSAPLNDGASALIMMTEDRANQLGLSPMAEVLGYAERGINPEVMGYAPYLAINQ
LVSQLNMSVNDIDLYEINEAFASQSVAVVRDLGISVDKVNINGGAIALGHPLGDSGARIV
TTLLHNLRRTDQEFGVASLCMGGGMGSALAIKLL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattgtaattatcgatgccaaacgatcagccatcggcaaattaaacggctca
ttatcttcattaactgccgaacaacttggttcaaaagtcacgcgtgctttattaaaagat
gctagtctttccggcagccaagttgatcaagttatctttggcaacgccatccaggccgga
aatggccaaaacattgcccgacaaatcgaattgaacagtcaaattccagaaagcaaaaca
gctttcacagtcaaccaagtctgtggttcaggactgcaagcaatccatcaagcacaatcc
gccttgcttctcggggaagtggaaacggtcattgccggcggaaccgaaagcatgtccaac
gttccttacttgaacatgtcacaacgaaaggcaaccaagtttgggccggtcacattatat
gatgggctgcaacgagacggcctaagtgattccgcgacggatgaaccaatgggaatgact
gctgaaaacgttgccgatcaatatcatgtctcacgtgaagaacaggatgcttttgcattg
cgatcacatcaactggctgcgcgagctactgaacagcattattttgatgatgaaattatt
cccattgaactcaaccaacccaaatcacacgctccccacatcgtagcgcaagatgaatcg
atccgggtcgacacaaatttggaaaaactggccgcccttcgtcccgcttttaaaccgaac
ggatccgtcactgccggcaacagtgcaccactaaacgacggcgcttctgctctgatcatg
atgactgaagaccgggcaaaccagttgggactatctccaatggcagaggtgctgggttac
gccgagcgcggaatcaacccggaagtcatggggtatgcgccctacttagccattaatcaa
ttggtctcccagctcaacatgtcagtcaacgacatcgacctctatgaaatcaacgaggcc
tttgcttctcaatcagtggcagttgttcgtgatctgggcatttcagttgataaagttaac
attaacggtggggcaatcgcactgggtcatccgctcggagattctggtgcccgcatcgtg
acgacgttattgcataatctgcgccggaccgaccaagaatttggcgttgcctctctttgt
atgggcggcgggatgggctccgcactggcaatcaaacttctttaa

DBGET integrated database retrieval system