KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0259Help
Entry
LEPBI_I0259       CDS       T00693                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00260  Glycine, serine and threonine metabolism
lbi00750  Vitamin B6 metabolism
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01230  Biosynthesis of amino acids
Module
lbi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEPBI_I0259 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LEPBI_I0259 (thrC)
Enzymes [BR:lbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LEPBI_I0259 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 DUF3548
Motif
Other DBs
NCBI-ProteinID: ABZ96404
UniProt: B0STJ0
Position
I:252066..253415
Genome map
AA seq 449 aa AA seqDB search
MSLTKYQFRAQFRCTNDSCRKTYPLHQVIYSCSSCGELLNVEHDLDSLKKIPAEEWKSTF
DSRFRSSQFPNASGVWGKKEWVLPEIQDQNIITSGEGTTHLYDASRFAKDLGLGSLHIKQ
CGVSHTGSFKDLGMTVLVSQVNQMIADGVPIKAVACASTGDTSAALASYAAKAGIPAIIL
LPANKVSTAQLIQPVSNGAIVLALETDFDGCMAVVKELTQEKSLYLANSMNSLRIEGQKS
ISVEITQQLGWKVPDWVVIPGGNLGNVSALGMGFEMMYELGLIGKLPRILLAQAKNASPL
YESYKKGFAEFSPVTAEKTLASAIQIGDPVSVKKAIRVLKKFDGIVEVATEEELANAAAK
GDLYGLYNDPHTGVALAALFKSIQKGTVGAGESVVVISTANGLKFTEFKLAFHEGKIPQV
DEALRNVILPCKPTLSGVMEILGKHLKKT
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttacaaaatatcaattccgagcacagtttcgctgtaccaatgactcttgtcgc
aaaacgtacccactccaccaagtgatttattcctgttccagttgtggagaacttctgaat
gtggaacatgatttagacagcctcaaaaaaatcccagcggaagagtggaagtctacgttc
gactctcgttttcgttcgagccaatttcccaatgcttctggcgtttggggtaaaaaagaa
tgggtgcttcccgaaatccaagatcaaaacatcatcacatccggggaaggaacgacacat
ttgtatgatgcctctcgttttgccaaagacttgggactggggagcctccatatcaaacag
tgcggagtttcccacacaggttccttcaaagatttaggcatgacagttcttgtcagccag
gtaaaccaaatgatcgccgacggtgttccgatcaaagcagtggcatgtgcatccactggt
gatacctcagctgctttagcttcttatgcggcaaaagcggggatccctgccatcatctta
cttccagctaacaaagtttcaacggcacaactcatccaacctgtatccaacggagccatt
gttcttgcattagaaactgactttgatggttgtatggccgttgtgaaagaactcacacaa
gaaaagtccctttacttagcaaattcaatgaattcccttcgcattgaagggcaaaaatcc
atttcagttgaaattacccaacaacttggttggaaggttcccgattgggttgtgatccct
ggtgggaatttagggaatgtgtctgctctcggaatgggatttgaaatgatgtatgagtta
ggactcattggtaaactcccaaggattttgttggcacaagcaaaaaatgcaagtcctctc
tacgagtcgtataagaaaggttttgcggagttctctcctgtgacggctgaaaaaacgtta
gcctctgccatccaaattggagacccagtctctgtcaaaaaagcgatccgtgttctcaaa
aaattcgacgggattgtggaagtggcgacagaagaagagttagccaatgcggcagcaaag
ggagatttgtacggactttataatgacccacacactggggtggcacttgcggctcttttc
aaatccatccaaaaaggaacagtgggagcgggtgagtcggtggtcgtgatttcgactgcc
aacggactcaaattcacagaattcaaacttgccttccacgaaggaaaaattcctcaagtg
gatgaggctctgaggaatgtaattttgccttgtaagccgacactttctggtgtgatggaa
atcctaggtaaacatttgaagaaaacataa

DBGET integrated database retrieval system