KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0722Help
Entry
LEPBI_I0722       CDS       T00693                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00780  Biotin metabolism
lbi01100  Metabolic pathways
Module
lbi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LEPBI_I0722 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lbi01007]
    LEPBI_I0722 (bioF)
Enzymes [BR:lbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LEPBI_I0722 (bioF)
Amino acid related enzymes [BR:lbi01007]
 Aminotransferase (transaminase)
  Class II
   LEPBI_I0722 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ABZ96854
UniProt: B0SL47
Position
I:736095..737264
Genome map
AA seq 389 aa AA seqDB search
MNRHWQEIQKKLESIKEKQLFRETKSYQGIDFCSNDYMGLTSNPNLLEYFESLKDEYPFG
STASRLVRGNYDSMDQFEREFANFVYGEAALLVSTGFVANFGLIDSIAAPDCYVFCDRLN
HASILDGIRISGAKKKYYNHLDLQHLKSLLDKADKEDPQKKQKRIVVTESLFGMDGDSPD
FKTLLKLKEEYDFVLVVDEAHSLGVYGPEGKGILFRDLTMDDIQSIDYRVYTLGKSFGLE
GGIIVTKKMGRDHLVNVMRPFIFSTAPLPIVSKLAIFALELLRSMDTLRSELHTLSVDFK
NSLLAIGFSITSTETHIVPLLLPSESEALYYAKRLQEMGLDVRAIRPPTVPTPRLRISLN
AKLTKKDTEALVTALVQIRKDWDESVPLV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtcattggcaagaaattcaaaaaaaattggaatccatcaaggaaaaacaattg
ttccgggaaaccaaatcttaccaaggcattgatttttgttcgaatgattatatgggtcta
acatctaacccgaatctgttagaatactttgaatccttgaaagatgagtatccctttggt
tcgactgcgtctcgccttgtccgagggaattatgattccatggaccaattcgaacgtgaa
tttgcaaactttgtttatggagaagcggcactcctcgtgtcaactgggtttgtggccaat
tttgggctaattgattcaattgcagcgcctgattgttatgtgttttgcgaccgtttgaac
catgcttccatcttagatggaattcgaatttcaggtgccaaaaaaaaatactacaaccat
ttagacttacaacatttgaaatcattattggataaggccgacaaagaagatccgcaaaaa
aaacagaaacgcatcgtcgtgaccgaatctctttttggtatggatggggatagtcctgat
tttaaaactctcctcaaactcaaagaagaatacgactttgttctcgttgtggatgaagcg
cattcattgggtgtgtatgggccagaaggaaaagggattttatttcgtgacttaacaatg
gatgacatccaatccattgactaccgagtgtataccttgggaaaatcatttggtttggaa
ggtgggattattgttaccaaaaaaatgggacgtgatcacctcgtcaatgtgatgcggcct
ttcattttttccacagcaccacttccgattgtatccaaattagcaatctttgctttagaa
cttttaaggtcgatggatactttgcgttctgagttacatactctgtccgttgattttaaa
aattctcttttggcgattgggttttcgatcacgagtaccgaaacacatatcgttccattg
ttattaccatctgaaagtgaagctttgtattatgccaaacgattgcaggagatgggtctt
gatgtgcgcgcgattcgtccaccaacggttcccacacctagattacggatcagtttgaat
gccaaattgacaaaaaaagacacagaggccttggttacggctctcgtccaaatccgtaag
gattgggatgagtctgttcctttggtgtga

DBGET integrated database retrieval system