KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0828
Entry
LEPBI_I0828       CDS       T00693                                 

Gene name
bioB
Definition
(GenBank) Biotin synthase (biotin synthetase)
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00780  Biotin metabolism
lbi01100  Metabolic pathways
Module
lbi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LEPBI_I0828 (bioB)
Enzymes [BR:lbi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     LEPBI_I0828 (bioB)
SSDB
Motif
Pfam: Radical_SAM BATS His_biosynth
Other DBs
NCBI-ProteinID: ABZ96955
UniProt: B0SLQ3
Position
I:841130..842185
AA seq 351 aa
MIAEVQEKTISSSPSIISEEEALQILKGEVPLLPVVAKASEERFRHFGNRVRIHILDNIK
NGYCPEDCGYCAQRKGGESGIQEYSLKSPEEIWEDAKKAKENGAYRFCMVTSGRGPTDKA
VDKLAETISKINGELGMKVCLSAGILDGKKAKTLKDAGLDRYNHNLNTSESKYNEICSTH
TFKDRLTTLEAAKEAEIGLCSGIIVGMGEELKDIVQVAFELKRLGVISIPVNFFIPIKGH
AIQKSTLTPEFCVRVLSVFRLVNPDSEIRVGAGREGHLGFLQSMALYVANSLFAEGYLNV
KGSEMEQTMNLIRDCNMVPEFTEGIPEGWEDYDSKFLYDEKNFPELYKHKK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgattgcagaagtccaagaaaaaactatctcttcctctccctctatcatttccgaggaa
gaagcccttcagattctcaaaggggaagtcccacttttacccgtggtagcaaaggcttcg
gaagaacgatttcgtcattttggaaaccgagttcggattcatatcttagataatatcaaa
aacggatactgccctgaagattgtggttactgtgcccaaaggaagggtggtgaatctggg
atccaagagtattctttaaaatcaccagaggaaatttgggaagatgccaaaaaagccaaa
gagaatggtgcctaccgattctgtatggtcacttcaggccgaggcccaacggataaagcg
gtcgataaattggcagagaccatttccaaaatcaatggggaactggggatgaaggtctgt
ctttctgcaggaatcttagatggcaaaaaagcaaaaaccttaaaagacgcaggacttgat
cgatacaatcacaacctcaatacatcggaatccaaatacaacgaaatttgttcgactcat
acctttaaagaccgactaacaacactcgaggcggcaaaagaagctgagattggtttgtgt
tccgggatcattgtgggaatgggggaagagctaaaagacatcgtccaagttgcctttgaa
ctaaaaaggttgggtgtgatctccatcccagtcaacttttttatccccatcaaaggccat
gccattcaaaagtcaacactcacacctgaattttgtgtccgagttttgtctgtgtttcgt
ttggtaaatcctgattctgagatccgtgtgggtgccggtcgtgaagggcatttgggtttc
ttacaatcaatggctctttatgttgccaattccctctttgcagaagggtatttgaatgtg
aaaggaagcgaaatggaacaaaccatgaatttgattcgtgactgtaatatggtaccagag
ttcactgaaggaattcctgaaggatgggaagactacgattccaagtttttatacgacgag
aaaaactttccggaactctataaacataaaaagtag

DBGET integrated database retrieval system