KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1496Help
Entry
LEPBI_I1496       CDS       T00693                                 

Gene name
gclK
Definition
(GenBank) Glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi00052  Galactose metabolism
lbi00500  Starch and sucrose metabolism
lbi00520  Amino sugar and nucleotide sugar metabolism
lbi00521  Streptomycin biosynthesis
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01200  Carbon metabolism
Module
lbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I1496 (gclK)
   00052 Galactose metabolism
    LEPBI_I1496 (gclK)
   00500 Starch and sucrose metabolism
    LEPBI_I1496 (gclK)
   00520 Amino sugar and nucleotide sugar metabolism
    LEPBI_I1496 (gclK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LEPBI_I1496 (gclK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LEPBI_I1496 (gclK)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LEPBI_I1496 (gclK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABZ97603
UniProt: B0SQE5
Position
I:complement(1556788..1557684)
Genome map
AA seq 298 aa AA seqDB search
MRQAIGVDIGGGSIRVSLFDENGSELDSHHTKTPEHLDNDSFLEVLVESIRPLVKNIIGI
GVGSPGPLNNETGVMLTSANMAGLKNLPIKSVLQKEFSLPVFYENDANCAALGEAIFGTY
KNTESQLILTLGTGIGGGFVKQGKLYTGYLGNGIEIGHTTSVIGGALCGCGVHGCVESYF
STKGFLNRYFEKTNTKLPNAEAFFSLVRSNDSESKSILEFGTKALAHAVRNAIQLLNPEA
VIFVGGITKSYDLFGALLEKEIRSTIFSVLNDRLLLGPGGNISGTLGAASLVFVKEKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaagcgattggtgttgatattggtggaggaagcatccgcgtttctctttttgat
gaaaatggaagtgaactagactcccatcacaccaaaacccctgaacacttagacaatgat
tcctttttagaagtactggtcgaaagcattcgcccacttgtaaagaatatcattggaatt
ggtgttggttcccctggccctctcaataacgaaacgggcgttatgctgacaagtgccaat
atggcaggtcttaagaacttacccatcaaatcagttttacaaaaagaattttcacttcca
gtattctatgaaaacgacgccaactgtgctgcattaggtgaagctatctttggaacgtat
aaaaacaccgaatcacaattaattttgacattaggaacagggattggtggagggtttgtc
aaacaaggtaaactttatacgggataccttgggaatggaatcgaaattggccataccact
tctgtcatcgggggcgccttgtgcggatgcggagttcacggttgtgtggagagttatttt
tccacaaaaggatttttaaaccgttattttgaaaaaaccaataccaaactccccaatgca
gaagcctttttttcactcgttcgatcgaatgattcagaatcaaaatccattttggaattt
ggaaccaaagctttagcacacgcagttcgtaatgcgatccaattactcaacccagaagcg
gtcatttttgtgggtgggatcaccaagtcctatgatttgtttggtgcacttttagaaaaa
gaaattcgatctacaatcttttctgtattaaacgatcgattattacttgggcctgggggc
aatatatcaggaactctgggtgccgcctcacttgtttttgttaaggagaaaaactga

DBGET integrated database retrieval system