KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1723Help
Entry
LEPBI_I1723       CDS       T00693                                 

Gene name
folD
Definition
(GenBank) FolD bifunctional proteins: Methylenetetrahydrofolate dehydrogenase/Methenyltetrahydrofolate cyclohydrolas
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00670  One carbon pool by folate
lbi01100  Metabolic pathways
lbi01120  Microbial metabolism in diverse environments
lbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LEPBI_I1723 (folD)
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     LEPBI_I1723 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     LEPBI_I1723 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABZ97829
UniProt: B0SRN4
Position
I:1795335..1796210
Genome map
AA seq 291 aa AA seqDB search
MKSSILLDGKAISEKIRNRIQETLAKAKAEGKGIPTLATILVGNNPASETYVNMKVKACE
KVGMHSRYIRLKEETTTEELLGEIRKLNLDPSINGILLQHPVPHQIDERKAFDEIALEKD
VDGVTTISFGKLSMNSEAYYPCTPYGMVLLLQEYGIDVTGKHAVVVGRSPILGKPMAIML
TNLNATVTLCHSKTEDLPSLVKQADIIVGAVGKPEFIKAEWMKEGVVILDAGYNVGNVGD
IEVSKAKDKSSYYTPVPGGVGPMTISVLLLQTMYSFLGQFSPKLESHVANR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctagcatcctattagacggtaaagcgatttccgaaaaaatccgaaatcgaatc
caagaaacattagcaaaagcaaaagccgaaggtaagggaattcccactttggcaaccatc
cttgttgggaataaccctgcatcggaaacctatgtgaacatgaaggtaaaagcctgtgaa
aaagtgggtatgcattcgcgttacatacgtttgaaggaagaaaccactaccgaagaactc
ttaggcgaaattcgaaaactcaatttagatccgagtatcaatggaatcttattacaacat
ccagtccctcaccaaatcgatgaacgtaaggcctttgatgaaatcgcattagaaaaagat
gtggatggggtgacaactatttcatttggaaaattgtccatgaatagcgaagcctattat
ccgtgcactccgtacggtatggttctactcttacaagaatatggaatcgatgtgacagga
aaacatgcagtggttgtgggaaggtctcctatccttggaaaaccaatggccatcatgttg
accaatttgaatgctactgtgacactttgccattcgaaaacagaagatttaccatcactt
gtcaaacaagccgatatcattgttggtgctgttgggaaaccggaattcatcaaagctgaa
tggatgaaagagggagtcgtgattttggatgctgggtacaatgtgggcaatgtcggagat
attgaagtttctaaggccaaagataaatcctcttattatactccagtacctggtggtgtg
ggaccgatgaccatttctgttttactcttacaaacgatgtatagttttttaggtcaattt
tcgcctaagttggagtctcatgtcgcaaatcgttag

DBGET integrated database retrieval system