KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1777Help
Entry
LEPBI_I1777       CDS       T00693                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase (Gamma-glutamyl kinase; GK)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00330  Arginine and proline metabolism
lbi00332  Carbapenem biosynthesis
lbi01100  Metabolic pathways
lbi01130  Biosynthesis of antibiotics
lbi01230  Biosynthesis of amino acids
Module
lbi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LEPBI_I1777 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LEPBI_I1777 (proB)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LEPBI_I1777 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABZ97883
UniProt: B0SRT8
Position
I:1854882..1855745
Genome map
AA seq 287 aa AA seqDB search
MKTRKDFLDSIQKSKLIVIKIGSARVSGEESKINDFLYDLVGDIRSLRDQGKEIILVSSG
AIAQGKKLLVQKSGSHLPNGKTSLAEKQALAAMGQNKLLNLYDSFFSRVNVPIAQILFGR
KDLNEENSFTNLKQTFRQLLDWGILPIVNENDSVSTEEINLGDNDILSAVVASVVGADLL
LILTGVDGFLNGSEKIDLFTEITKETESLATGPSGPGTGGMFTKINAAKLLLPFGIKTGI
ANGETKHAINQFFSRESFGTLVANGSFPHRIPSASEIQSHFFSYQVE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtaaggattttttagattccatccaaaaatcaaaactcatagtcattaaa
attggtagtgcgcgggtttctggcgaagaatctaaaattaatgattttttatatgatttg
gtaggtgacattcgttcccttcgtgaccaaggaaaagaaatcattcttgtatcctctggt
gcgatcgcacaagggaaaaaactcttggttcaaaaaagtggttctcaccttcccaatgga
aaaacgtcacttgccgagaaacaagcgctagctgctatggggcagaataaacttctcaac
ctatatgatagtttttttagtcgcgtgaatgttcccattgcgcaaattttatttggacga
aaggacttaaacgaagaaaatagtttcacaaatttgaaacaaacattccgtcaacttttg
gattggggaattttacccattgtgaatgaaaacgattctgtttccacggaagaaatcaat
ttaggtgataatgacattctttctgccgtagttgcctctgttgtaggtgcagaccttctt
ctcatacttacaggtgtggatggttttttaaatggatccgaaaaaattgatttgtttact
gaaatcacaaaagaaacagaatctttggcaacgggtccttctggtcctggtacgggtgga
atgtttacaaaaatcaacgccgcaaaacttttgttaccatttggaatcaaaacaggaatt
gcaaatggcgaaacaaaacatgcaatcaatcaatttttttcaagagaatcgtttgggacc
ttggttgccaatggaagttttccacatagaattccttccgcttctgaaatccaatcacac
tttttttcctatcaggtggagtaa

DBGET integrated database retrieval system