KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2081Help
Entry
LEPBI_I2081       CDS       T00693                                 

Gene name
pgk
Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01200  Carbon metabolism
lbi01230  Biosynthesis of amino acids
Module
lbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbi_M00002  Glycolysis, core module involving three-carbon compounds
lbi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I2081 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbi04147]
    LEPBI_I2081 (pgk)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     LEPBI_I2081 (pgk)
Exosome [BR:lbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   LEPBI_I2081 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ABZ98183
UniProt: B0SSU3
Position
I:2175861..2177051
Genome map
AA seq 396 aa AA seqDB search
MKLPLLEEQNLKGKRVFVRVDFNVPVENGKATDRTRIEKTLPTLELLISKGAKIILGSHL
GRPKGGPEPKYSMKPVFDVLSELVKTKVSFSESVIGSDVVKMTNALGEGEILLLENLRFH
KEEEENVASFCKELAKLADVYVNDAFGTAHRAHASTEGVAHLLPAFAGLLMRKEIEVLSG
LLAKPERPFVAIVGGSKVSSKFAILKNLLEKVDHLLIGGGMAYTFLKSRAVPVGKSLVEP
EFESQAFQLIDRAGIQGVDLQIPVDHIIADAFDPNAKTKSVDKMGIIDGWMGMDIGPKTI
DNYVKAIKDAKTILWNGPMGVFEMDKFSKGTIEIAKAISKSKAKTVVGGGDSIAAVNKAG
VADKITHISTGGGASLEFLEGRTLPGVQCLLPKEEK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacctcttctcgaagaacaaaatctaaaaggaaaacgagtctttgttcgtgtg
gatttcaatgtccctgtggaaaacggaaaagcaacggacagaactcggattgaaaaaacc
ctccctactttggaacttctgatttccaaaggtgctaaaatcattttgggaagccactta
ggtcgcccgaaaggtggaccggaaccgaagtattccatgaaaccggtgtttgatgttctt
tccgaacttgtcaaaaccaaagtgagtttctcggaatctgtgattggttccgatgtggtg
aaaatgacgaatgcgcttggggaaggtgaaatcctacttttagaaaaccttcggttccat
aaggaagaagaggaaaatgttgccagtttctgtaaggaactggcaaaactcgctgatgtt
tatgtcaatgatgcgttcggaacggcacacagagcacatgcttcgacagaaggtgtggcc
cacctactccctgcctttgcgggactactcatgcgaaaagaaattgaagtcctcagtggc
ctactcgcaaaacctgagcgtccttttgtggctattgtgggtggatccaaagtcagttcc
aaatttgccattttaaaaaacctcctcgagaaggtagaccacctcctcattggtgggggt
atggcatacacgtttttaaaatcaagagcggttcctgtgggaaaatcccttgtggaacca
gaatttgaatcccaagccttccaactcattgaccgagctgggatccaaggggttgacctg
caaattccagtggaccacatcattgcggatgcctttgatcccaatgccaaaacaaagtct
gtggacaaaatgggaatcatcgatggttggatgggaatggacattggaccaaagaccatc
gacaactatgtcaaagcgataaaagatgccaaaaccattttatggaacggcccaatgggt
gtctttgaaatggataagttctcaaaaggaaccatcgaaatcgccaaagccatcagtaaa
tccaaggccaaaaccgttgtgggtggtggtgattccattgccgctgtgaacaaagcggga
gtagcggacaaaatcactcatatttccacaggtggaggtgcttccttagaatttttggaa
ggacgaactctccctggcgtacaatgtttactcccaaaggaagaaaaataa

DBGET integrated database retrieval system